2XVA,3M70


Conserved Protein Domain Family
TehB

?
pfam03848: TehB 
Click on image for an interactive view with Cn3D
Tellurite resistance protein TehB
Statistics
?
PSSM-Id: 397776
Aligned: 4 rows
Threshold Bit Score: 342.214
Threshold Setting Gi: 295982502
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2XVA_B   3 MVIRDENYFTDKYELTRTHSEVLEAVKVVKPGKTLDLGCGNGRNSLYLAANGYDVDAWDKNAMSIANVERIKSIENLDNL 82  Escherichia coli str....
Q9ZC59  98 FYCQPEDFYHKKYNLTPTHSEVIEAVKTVKPGKALDLGCGSGRNSLYLNLLGFDVTAVDKNNDSIGNLQQIIDKEALKGI 177 Yersinia pestis
3M70_A  91 FYCKKEDYFSKKYNTTAIHGDVVDAAKIISPCKVLDLGCGQGRNSLYLSLLGYDVTSWDHNENSIAFLNETKEKENLN-I 169 Haemophilus influenzae
Q9CMZ4  91 FHCKKKDYFHKKYNMTPTHSEVKSAVEILSPCKVLDLGCGQGRNSLFLSLLGYNVTAWDHNENSIKFLQDTAEKENLT-I 169 Pasteurella multocida
2XVA_B  83 HTRVVDLNNLTFDRQYDFILSTVVLMFLEAKTIPGLIANMQRCTKPGGYNLIVAAMDTADYPCTVGFPFAFKEGELRRYY 162 Escherichia coli str....
Q9ZC59 178 TASSYNINEASLDERYDFILSTVVLMFLQPERIPHIISNMQECTLPGGYNLIISAMSTDDFPCTVPFSFTFQSGELKDYY 257 Yersinia pestis
3M70_A 170 STALYDINAANIQENYDFIVSTVVFXFLNRERVPSIIKNXKEHTNVGGYNLIVAAXSTDDVPCPLPFSFTFAENELKEYY 249 Haemophilus influenzae
Q9CMZ4 170 QTALYDINSAKISENYDFILSTVVFMFLKPQCISQIIENMQTHTNVGGYNLIVAAMSTEEVPCPVPFSFTFKENELKTYY 249 Pasteurella multocida
2XVA_B 163 EGWERVKYNEDVGELHRTDANGNRIKLRFATML 195 Escherichia coli str. K-12 substr. MG1655
Q9ZC59 258 QDWAILKYNEDVGQLHKTDAQGNRIKLRFATLL 290 Yersinia pestis
3M70_A 250 KDWEFLEYNENXGELHKTDENGNRIKXKFATXL 282 Haemophilus influenzae
Q9CMZ4 250 QDWELVKYNEEMGELHKTDENGNRIKMKFVTML 282 Pasteurella multocida
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap