Conserved Protein Domain Family
RasGAP_C

?
pfam03836: RasGAP_C 
RasGAP C-terminus
This domain can be found in the C-terminus of the IQGAP family members, including human IQGAP1/2/3, S. cerevisiae Iqg1 and S. pombe Rng2. Some members function in cytoskeletal remodelling. Human IQGAP1 is a scaffolding protein that can assemble multi-protein complexes involved in cell-cell interaction, cell adherence, and movement via actin/tubulin-based cytoskeletal reorganization. IQGAP1 is also a regulator of the MAPK and Wnt/beta-catenin signaling pathways.Iqg1 and Rng2 are required for actomyosin ring construction during cytokinesis.
Statistics
?
PSSM-Id: 397769
Aligned: 115 rows
Threshold Bit Score: 88.7767
Threshold Setting Gi: 891580842
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q5AH02              1413 YHELKKMCLEIILKLESMGELTRKNSFQTLLNQIAMDIKTKDSQRQCRWQQLQVSQKTIKKLSEKENYLKTQLHNYKKHV 1492 Candid...
EPB90481             588 LVSKGIKARTLLEELEEAGIVSQENNYELLVQEIKQELIHLGDLKDRMILEIMSLEQVFKTIQDHNNYLQSQLETYKAYL 667  Mucor ...
EKD04042             595 LVRRGIKVQNLLSELEAAGVLDRTDNYKLLQDEVRTELVHLGNAHEKVLLETRSLEEVFHAICNHNQYLRNQIDSYKAYL 674  Tricho...
XP_014569815         594 LVRKGIKVQEMLRELEELKLVDRKDGYKFITEEVTGELTHLGNLKEKVILESRSLDAVFKTICDHNNYLRSQLEQYKAYL 673  Mixia ...
EXX67063             576 LVRKGIKVKEMLRELEEAHVINRRDGYKLMTEEVAQELVHLGNLREKVNEEIKSLETVYKTICDHNNYLRSQLDSYKAYL 655  Rhizop...
CCG80715             527 MVRKGLKALEMLRELSEQNLVDSRDRYNPLTEEVEQELVHLGSIRDKVVLETKSLHSVYKTICDHNEYLKGQIDTYRAYL 606  Taphri...
WGS:AFWA:PNEG_00235  541 LVRKGIKAIEYLKELSELKLIDPNDFYNPLAEEVEHEIAHLGSLYEEVLRETESLESVYKTIEDHNEYLRGQLEQYKSYL 620  Pneumo...
XP_002173585         564 fMHKGLRALQYLEELSKLSVVDPLNRYAPLVSEVEHEFQNLDAVYQRLKTERDALFMVHKTISEHNEYLRSQLDIYRNYL 643  Schizo...
P33277               555 LMKKGIRAIELLDELSTLRLVDKENRYEPLTSEVEKEFIDLDALYERIRAERDALQDVHRAICDHNEYLQTQLQIYGSYL 634  Schizo...
CCX07560             583 mFRKGMRGLELLNQLQELGVISDQDNFMILREEIEQELVHLGSLKEKVMEETKKLEEVYKTIRDHNAYLVSQLETYKSYL 662  Pyrone...
Q5AH02              1493 ESVLLEL----------------------QSKSksndknwkrrlfnimvipvFSKqyfyhrelrkhNRLPKFGSYKYSAK 1550 Candid...
EPB90481             668 QNVRMQSagggmvsq------staattlvKSNN-------------------SKK--------------KSTGPFRFTHQ 708  Mucor ...
EKD04042             675 FNSRMMMskdkgagg------vgvvsfngKDKK---------------------------------ARSQSLGPYRFTHQ 715  Tricho...
XP_014569815         674 QNVRQTSgaqkgktgg-----vgvvsvdgKDKK-------------------VVK-------------TQALGPYKYTHA 716  Mixia ...
EXX67063             656 LNVRQQDakggpga--------svvklggKEKS--------------------QK-------------IKVLGPYKFTHT 694  Rhizop...
CCG80715             607 LNVRGQSsvtkhseanr---gigvvaisgKQKK-------------------AGK--------------LLLGPYRYTHA 650  Taphri...
WGS:AFWA:PNEG_00235  621 HNVRIHSgrneskigvm--ggvgvvslggKEKK-------------------QKK-------------QQVLGPYKYTHF 666  Pneumo...
XP_002173585         644 QNARVQSsitkhsdlknvsrgvgvvgfkgKQQ-------------------------------------KQTNASKFSHA 686  Schizo...
P33277               635 NNARSQIkpshsdskgfs-rgvgvvgikpKNI-------------------------------------KSSNTVKLSSQ 676  Schizo...
CCX07560             663 HNVRSQSegkqr-------------naggKQQK-----------------------------------PQVLGPYKFTHQ 694  Pyrone...
Q5AH02              1551 KLIDQKVLIDFSTA 1564 Candida albicans SC5314
EPB90481             709 QLEKDGIIVESEVP 722  Mucor circinelloides f. circinelloides 1006PhL
EKD04042             716 QLEKEGVVKSSAVP 729  Trichosporon asahii var. asahii CBS 8904
XP_014569815         717 QFEKDGIIVDSNVP 730  Mixia osmundae IAM 14324
EXX67063             695 NLEKDGIIVETSVP 708  Rhizophagus irregularis DAOM 197198w
CCG80715             651 ELEQRGIIAESNVP 664  Taphrina deformans PYCC 5710
WGS:AFWA:PNEG_00235  667 QLEKELVIAESNVP 680  Pneumocystis murina B123
XP_002173585         687 HLVKEQVIAEClfp 700  Schizosaccharomyces japonicus yFS275
P33277               677 QLKKESVLLNCTIP 690  Schizosaccharomyces pombe 972h-
CCX07560             695 QLEKEGVIQKSNVP 708  Pyronema omphalodes CBS 100304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap