6HMS


Conserved Protein Domain Family
PolC_DP2

?
pfam03833: PolC_DP2 
DNA polymerase II large subunit DP2
Statistics
?
PSSM-Id: 397766
Aligned: 64 rows
Threshold Bit Score: 1211.98
Threshold Setting Gi: 74579945
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6HMS_B                  9 EYFEMLQREIDKAYEIAKKARAQGKDPSLDVEIPQATDMAGRVESLVG-------PPGVAKRIRELV-KEYG--KEIAAL 78  
Q74N29                  2 VYYDILAKELEKLYEIAEKARAQGYDPKDIVEIPLANNMGERVAHLISaiheqldVKKTAELILELE-KQYGflDWRVGL 80   Nanoa...
WP_012310170            2 DYFDTLRKGMDELLSVARRARSLGLDPSNDIEISLANELHERIAALFG-------IPELGERVKYWLdATGS--KLETAF 72   Candi...
BAJ47018                7 EYRSNILREVDRVYAVASAYRERTREPLPFVETVFADRMEERVELLVG-------PHGVAEKIRRLR-ERLS--GIELAF 76   Candi...
goetting:Ngar_c35970   21 RYQQDILENVHKNYQHALKARRRGIDAADIVEPKIAYDLADRVAKMHE-------ID-IADRLRALL-TTTT--KEKAAL 89   Candi...
A0RYM0                 21 RYYSSLSGGTYDIFEKAASAKSNLADSSGMVEPKIAVDLSDRVAKMHD-------LD-IAGPLRELL-ATKG--KELAAL 89   Cenar...
agres:mru_0240          6 DYFERLESETQRLYEIANEARSKGFDVELETEIPVAKDLAERVEGLVG-------PKGIARRIKELEaTGIS--REEVAF 76   Metha...
NZAGRC:Abm4_0155        2 DYFDRLEKETLELYDIANEARSKGLDMTTECEIPRAKDLAERVEGLVG-------PEGVAKRIKELE-AELNd-REKVAF 72   Metha...
Q2NHG2                  2 DYFGMLEEKTKELYAIAREARKQGKDLELEPEIPLAKDLAERVEGLVG-------PEGVAKRIKELE-KSMS--REEVAF 71   Metha...
WP_013413924            4 EYFDSLEKEIKKVYKIAETARSKGLDPSPTPEIPLAKDLAERVEGIVG-------PKGISKEIKKLEeKGIS--RENIAF 74   Metha...
6HMS_B                 79 KIVDEI-----IEGKFGDLGSREKYAEQAVRTALAILTEG-IVSAPIEGIANVKIKRNTwaDNSEYLALYYAGPIRSSGG 152 
Q74N29                 81 KLIDYA-----LEGKLIPYDDILKRIDLGVRLALGYITMG-VVSAPLEGLVELRIKKRK--DGKPYLALYYAGPIRGAGG 152  Nanoa...
WP_012310170           73 RVIGEI-----VPGYYLKI-SYERRAELALRVGMAIITDA-TVSAPIEGISKVEVKK----QGGTYLSVYYNGPIRTAGG 141  Candi...
BAJ47018               77 KLCEEI-----VYSSL-GAESEEKVIHQAVCTALAVLTPPcITAAPSEGISHVRIKEND--DGTRYLAVYFAGPIRAAGG 148  Candi...
goetting:Ngar_c35970   90 KIAEEI-----AAGEY-GSGDLKTRLDNAVRVSLAVVTEG-VTVAPLQGISDVTIKNNA--DGSQYLSVSFAGPIRSAGG 160  Candi...
A0RYM0                 90 MLAKEI-----MDGKYLPEADIEKRIDSAVRVGLAVVTEG-VTIAPLQGIADVITKKNK--DGSEYLSVSIAGPMRSAGG 161  Cenar...
agres:mru_0240         77 EIAAEIasqesSETGAKLEAEKQAFADQGLRTALAIITEG-VVAAPLEGISGVKIKSNS--DGTKYVAVYFAGPIRSAGG 153  Metha...
NZAGRC:Abm4_0155       73 EIAAEIasqdiEEEGKAAEEKRQQLADQGLRTALAILTEG-VVAAPLEGISQVLIKENP--DGGKYIAVYFAGPIRSAGG 149  Metha...
Q2NHG2                 72 QIAKEIatkddVEGQPNDYEVQEANADSAIRTALAILTEG-VVAAPLEGIAKVKIKDNS--DGTKCFGVYFAGPIRSAGG 148  Metha...
WP_013413924           75 TIAKKIv---------SKGNNKEKMAEQALRTSMAVLTEG-VVAAPIEGIAKVKIKDNY--DGTKYLSVYYAGPIRSAGG 142  Metha...
6HMS_B                153 TAQALSVLVGDYVRRKLGLDRFKPS--EKHIERMVEEVDLYHRaVTRLQYHPSPEEVRLAMRNIPIEITGEATDDVEVS- 229 
Q74N29                153 TAAAVSVLFADYARKKAGLYEYDPT--KEEIERYKIEIDSYHNkVARLQYKPSDEEIEFLVKHIPVEINGDPTSDKEVPs 230  Nanoa...
WP_012310170          142 TEGAISVLMADYIRQRLGIDRYRPT--QEEIERYVEEVSLYKR-IAHLQYNSEPNEVRIAVSNLPVEITGPPTEKEEVSs 218  Candi...
BAJ47018              149 TELASVVVLADYVRRLLGLDRFKAR--EEEVKRFVEELRTYIRhVGRFQYSVPDKLIAYAYRMTPVEISGVATDEIPVPs 226  Candi...
goetting:Ngar_c35970  161 TEAALTMLIADHARKVAGLGKYIANsfDDETGRFVEELRIYEReVMGFQFKVLDEDVIKCISNLPVELDGVDTDPVEVVg 240  Candi...
A0RYM0                162 TESAVTMLIADYVRRQAGLAEYQADslDDETGRFIEELRIYEReVGSFQFHVLDEDIRAVISHLPVELDGVDTDPYEVVn 241  Cenar...
agres:mru_0240        154 TAAALSVLLGDKIRVATGLDRFKPT--DDEIERYVEEVELYESeVTNLQYSPTPEEVRFAARSIPVEVSGEPTDQIEVS- 230  Metha...
NZAGRC:Abm4_0155      150 TAAALSVLLGDKIRVATGLDIYKPS--DDEIERYVEEVELYESeVTNLQYSPTPEEVRLAARSIPVEVSGEPTDQIEVS- 226  Metha...
Q2NHG2                149 TAAALAVLLGDYIRMSQGLDRYKPT--DDEIERYVEEVELYESeVTNLQYSPTPDEVRLAIRGIPVEVTGEQTDPVEVQ- 225  Metha...
WP_013413924          143 TASALSVLIADYIRKELGLDVYKPI--EEEIERYVEEVELYESeVTNFQYSPSPDEVRLVASNIPVEITGEPTDKIEVS- 219  Metha...
6HMS_B                230 HRDVPGVETNQLRGGAILVLAEGVLQKAKKLVKYI----DKMGIEG--WEWLKEFVEA--------Kekgepkeegkees 295 
Q74N29                231 YKNLERVETNRIRGGMCLVIAEGIAQKAKKIYGKItewgKEFGLEH--WEFLGEYLKLqkeiqaklA------------- 295  Nanoa...
WP_012310170          219 FRNLPRVETNRVRGGAVLVINDCIIQKAKKLKKIIdq-iKKIGFDDscWGWIE--------------------------- 270  Candi...
BAJ47018              227 FRDLERIETNYLRGGALRVVNDGIVGRAKKVLNTV----RSMKMSG--WDWVEELAKAs------iK------------- 281  Candi...
goetting:Ngar_c35970  241 HKGMRRIATDRVRGGTLRVMNDGLIGRSRKLLKLV----ETLKLDG--WGWLKDLKGA---------------------- 292  Candi...
A0RYM0                242 HKGMSRIQTDRVRGGALRVLNDGLIGRSKKLLKRI----ELYGLDG--WEWLAELKGA---------------------- 293  Cenar...
agres:mru_0240        231 HRDLPRVETNNIRGGALLAMVEGVIQKSKKILKIS----KKLNLDS--WEFLAEYAKGig----ssQ------------- 287  Metha...
NZAGRC:Abm4_0155      227 HRDLPRVETNNIRGGALLAMVEGVIQKSKKIHKIA----NKLGLDK--WEFLLEYAKP--------K------------- 279  Metha...
Q2NHG2                226 NRDLPRVETNNLRGGALLAVAEGVIQKSRKIVKYA----KTLKIDG--WDWLEYFTAPks----tkE------------- 282  Metha...
WP_013413924          220 YRNLERVETNHLRGGALLVLVEGLIQKASKVVKYA----EKLNLDN--WKWLKKFLKV---------------------- 271  Metha...
6HMS_B                296 lAESTLEETKvevdmgfyyslyqkfK--------------------EEIAPSDKYAKEVIGGRPLFSDPSKPGGFRLRYG 355 
Q74N29                296 -AESGGEIEG---------------KeikrkitlfldeikkeeitvKYPTPAGKYLQEITAGRPIFSLPMAIGGFRLRYG 359  Nanoa...
WP_012310170          271 --GKKEEESE---------------Eeag---------------gcPVIEPSYKYLKDAVMGRPVLSHPSRIGGFRLRYG 318  Candi...
BAJ47018              282 -KEENGEEGS---------------L-------------------------------EVIGGRPVLSLADRFGGFRIRYG 314  Candi...
goetting:Ngar_c35970  293 --IQTGDDD-----------------------------------------AAHHRMSEVITGRPVLSMAKKIGGFRLRYG 329  Candi...
A0RYM0                294 --VQTGENKE---------------D------------------------AAAKRMREVITGRSVLSMPNRLGGFRLRYG 332  Cenar...
agres:mru_0240        288 -EEEKSEEET---------------Eeiveeid-------dniidkDELFAHSKYAHDIIGGRPVLGYPSEKGGFRLRYG 344  Metha...
NZAGRC:Abm4_0155      280 -TDDSDDDES---------------Kgdgeevs-------sipgevDQKPIFAKYIQDIIGGRPVLSYPSEKGGFRLRYG 336  Metha...
Q2NHG2                283 -EEKKKEESS---------------E--------------------NKPKKKAKYMEDIIGGRPVMSYPGAKGGFRLRYG 326  Metha...
WP_013413924          272 -----EEDEE---------------E--------------------VNVKPNDKYLKDVIGGRPVLAYPSKKGGFRLRYG 311  Metha...
6HMS_B                356 RSRASGFATWGINPATMILVDEFLAIGTQLKTERPGKGAVVTPVTTIEGPIVKLKDGSVLRVDDYNLALKVREDVEEILY 435 
Q74N29                360 RSFATGFATSGIHPATMFLTYGFLAIGTQMRGERPKKSTIVTPVTSLHPPIVKLKDGTVKKVHSVVEAIKIANDVEEILF 439  Nanoa...
WP_012310170          319 RARNTGLASIGMNPATMYLLDSFIAVGTQVRIERPGKSAVVMPVDSIEGPTVRLRDGSVIRVDDPDEAMRIMDQVEEIIH 398  Candi...
BAJ47018              315 RAFSTGMAAYGIHPLTMRVLKGYIVTGTQLKTDFPGKGGIVTPVDVIEPPVVKTRSGDVVKLTSEETFRKIADSIDRVLF 394  Candi...
goetting:Ngar_c35970  330 RCYNTGFATVGIHPAVPALLNYAIVAGTQIKMDMPGKASTIALVDTLEAPLVRLDDGRVMPVPTVEQAERIRTRVNKILY 409  Candi...
A0RYM0                333 RACNTGYTSVGFHPAVAEILDHTIAVGTQVKIDIPGKGATVAFVDTIEAPTVRLAGGDVVKIRDVAHGIELKGSIERILH 412  Cenar...
agres:mru_0240        345 RSRNTGLATMGVHPATMELL-EFLAVGTQLKIERPGKGNCVVPVDSIEGPTVKLKSGEVRRLDSIADAREVKGKVVEILF 423  Metha...
NZAGRC:Abm4_0155      337 RSRNTGLATMGVHPAVMEII-EFIAVGTQMKIERPGKGNCVVPVDSIEGPIVKLKNGNVLQIDSIKEARKVKKDIAEILF 415  Metha...
Q2NHG2                327 RTRDSGLASMAIHPATMEIV-EFLAIGTQMKIEKPGKGNCVVPCDSIEGPIVKLKNGDVIQVNDVSKAISIRRDVNEIIF 405  Metha...
WP_013413924          312 RARNTGLAAMGLHPATMEIL-EFTAVGTQMKIERPGKGNCVVPVDSVEGPIVKLKNGDVIKVKSREEARKIKNEIDEILF 390  Metha...
6HMS_B                436 LGDAVIAFGDFVENNQTLLPANYCEEWWILEFVKALkeiyevhlepfteneeesieeasdyleidpeflkemLRDPLRV- 514 
Q74N29                440 LGDILTAFGDWLNEKANLVPSPYVEEWWIQEFDRAA------------------------------------MKKTDYKi 483  Nanoa...
WP_012310170          399 LGDVLIGYGEFLENNHPLLPSAWVEEWWEALVRRKG------------------------------------LRA----- 437  Candi...
BAJ47018              395 LGDILVSVGDCVENNVELRPAGYCEEWWLKDYLNMV------------------------------------AShglenv 438  Candi...
goetting:Ngar_c35970  410 LGDMLISYGDFLENNAQLPPASYVEEIWAQQLKSKL------------------------------------PALPVVDs 453  Candi...
A0RYM0                413 LGDMLISFGDFLENNAQLVPSGYVEEIWKMDMEAAG------------------------------------AAQGS--- 453  Cenar...
agres:mru_0240        424 LGDMLVAFGEFLRNNQPMLGSCWCEEWWIECIRnsdkyksfsndselydyliergidlsie------------------- 484  Metha...
NZAGRC:Abm4_0155      416 LGDMLIAFGEFLRNNQPMLQAGWCQEWWIEHIRnsskyqsegdn------------------------------------ 459  Metha...
Q2NHG2                406 LGDMLVAFGEYLRGNIPLDVSAWCEEWWAQEIEaseyfkethdtfgi--------------------------------- 452  Metha...
WP_013413924          391 LGDILVAPGEFINNNHPFMPSAWCEEWWKKLLNKDI------------------------------------E------- 427  Metha...
6HMS_B                515 ----------------------------------------KPPVELAIHFSEVLGIPLHPYYTLYWNSVEPKDVEKLWRL 554 
Q74N29                484 efdvmkprklfkieglenlsqylgipkdrleeiirkpfsrKPTIDEAITISEKLGIPLHPEYTPFWVHITKEELIKLIEE 563  Nanoa...
WP_012310170          438 ----------------------------------------VRGFEDALRASRELDVPLHPRFTYYWEHITSEELLKLAGA 477  Candi...
BAJ47018              439 aektgipl-------------------krlklfaanpftaKPTAEEALTLSIHTGIPLHPSHLHFWTNITTHQINQLRTW 499  Candi...
goetting:Ngar_c35970  454 nrerliq--------------------------laenplvAPSLEEAFDISSKLGIPLHPRYSFYWDTVGLDEALYLKDR 507  Candi...
A0RYM0                454 ----------------------------------------PSSADEAVRISRELGVPLHPRYLYYWDQISHEELAMLLSP 493  Cenar...
agres:mru_0240        485 -------------hfishedsskymdfdresfnlnflekkRYTAEEAFRISYDFSVPLHPEYTYYYNDISREDLAYLNEW 551  Metha...
NZAGRC:Abm4_0155      460 -----------------------------heldlktlefeKISAPEAFRISKEYKIPLHPDYTYCYHDISKEELNDLINW 510  Metha...
Q2NHG2                453 --------------------------dfnenmelnallklDIDAKKAFDIAKKTNTPLHPKFTFYYNDVTKEELNDLHNY 506  Metha...
WP_013413924          428 ----------------------------------------PKNAKEAFEISKKYNVPLHPKYTYFYHDVSVKELNRLYNW 467  Metha...
6HMS_B                555 LKNYAeiewsnfrgikfakkivisqEKlgD----SKRTLELLGLPHTVRDGNVIV--DYPwaAA---LLTPLGnLnwefm 625 
Q74N29                564 LRKAKiqnnki---------yfhesQK--E----LKAILEKLFIEHFREGEYFYIneS---------MTKSLL-Yqldnl 618  Nanoa...
WP_012310170          478 IRNSErae--------------idlNE--D----IKRILELLGVPHRVQNGKIVLdeEDW--KAlsyIASKLP-Eslel- 533  Candi...
BAJ47018              500 LKTGLmhhgek---------hvyrlDP--D----IKQILEAILLEHRIIDGKIILseQDQ--IV---LSTLLR-Pgeefe 558  Candi...
goetting:Ngar_c35970  508 LADDN--------------------EI--PndakLKDILERLGVAHSIARDKIRVdnNDQ--AAs--LRRLLGgpiv--- 558  Candi...
A0RYM0                494 LDKGD--------------------AI--SypaaCKPVLEKLGVPHKAGPEGPVLegDEA--RI---FRELI--Ldnppg 544  Cenar...
agres:mru_0240        552 LDTKRdylstdyln---gedlildlAP--Q-----KRILEILGLVHKLIDKKVVIdrDHA--YA---LMKTVG-Ngsale 615  Metha...
NZAGRC:Abm4_0155      511 ILPQIkdykdgd-------eivldkSY--Q-----KRILEVIGVLHTVDDGKIILdsDTS--YA---IVHTLR-Rpfnde 570  Metha...
Q2NHG2                507 LYSLIdspedv---------fksdmNR--IpidyHKRIIEVLGIPHHVNNKSLIMsnDNL--YT---LMSVLN-Kslsp- 568  Metha...
WP_013413924          468 LRSSKyisgkg---------lrlkiSD--E-----KKILEKLGVPHHIKDSKVIIkdDHA--YA---LLNTLR-Kplde- 524  Metha...
6HMS_B                626 ---------------------akplyATIDIINENNEIKLRDRGISWIGARMGRPEKAKERKMKPPVQVLFPIGLAGGSS 684 
Q74N29                619 nlek-------------akkefdnaiDALDLVNRLSPIEIRDVAGVYVGFRAGRPEKAKMREMTGRPHGLFPVGEEGGKM 685  Nanoa...
WP_012310170          534 -----------------------pryATIKVLNQYLDVKVMPKGPTKIGMRVGRPEKAKPRKMKPPVNLLFPVGNLKGSS 590  Candi...
BAJ47018              559 ---------------------pftdeGPLQFIHRISGVEVRDKRGSSLTARMGRPEKAGPRKTSPAVHFLFPIGLAGGAT 617  Candi...
goetting:Ngar_c35970  559 -----------------------eakDTIEFVTKSSGVVVRPKFASTIAVRVGRPEKAAERKMKPPVHVLFPVGPKGGAT 615  Candi...
A0RYM0                545 ---------------------pdasaPVPELISRSSGITIRDKFSTSIGVRIGRPEKAAPRQMRPPTHCLFPVGGTGGPT 603  Cenar...
agres:mru_0240        616 dndgdlssevktidyskyldddhyksKVVDILNENIDFEIMDKAPCYIGTRVGRPEKSKERMMRPAPHVLFPIGNNGGSR 695  Metha...
NZAGRC:Abm4_0155      571 e-------------------lsnhdlKVMDVLNDISEVPIEYKAPVYIGTRVGRPEKSKERLMRPAPHVLFPVGTYGGSR 631  Metha...
Q2NHG2                569 ----------------------dedmETIEAVNMISPVSIKSKAPTYIGGRVGRPEKTKERLMKPAPHSLFPIGNYAGNI 626  Metha...
WP_013413924          525 -----------------------sldDPLKALNKISPVKIMPKAPTYIGGRIGRPEKSKERRMRPAPHVLFPIGKSGGNR 581  Metha...
6HMS_B                685 RDIKKAAEEGKVaEVEIAFFKCPK--CGHVGPEHLCPNCGTRKELLWVC------------------PRCNA--EYP-ES 741 
Q74N29                686 RNVIEAYNKGYV-KAEFALYYCNH--CKRYTIYRKCEVCGNKTKEVYVCkeiinrlktslfkqykdwKKVEEeiASHlWA 762  Nanoa...
WP_012310170          591 RSLDLAYEKGSV-NVEVALRLCRK--CGSRTTLFRCPNCGSPTYKISFC------------------PICGKqvNGKcQD 649  Candi...
BAJ47018              618 RDIVSA--KTSIvTVELVTRLCIN--CGKIGWRETCSECGSYTTLYGVC------------------RNCKKqfTEFvEK 675  Candi...
goetting:Ngar_c35970  616 RDILKACKEEDSfYTEIANRYCDN--CKIPSIGTHCRTCGASTMLRNLC------------------IQCRG--EVEeGE 673  Candi...
A0RYM0                604 NNLLKSAA-RPGfSADILSRRCPG--CGEPSISIRCWACGERTAVERTC------------------MQCGTdvDGEe-- 660  Cenar...
agres:mru_0240        696 RLVAEAAKKRKI-NVEIARRQCTNpdCGLSSFMAICPHCGAPTEI----------------------------------- 739  Metha...
NZAGRC:Abm4_0155      632 RLVAEAAKKGNI-RIDIARRQCTNpaCGLSSNQALCPYCGSPTEF----------------------------------- 675  Metha...
Q2NHG2                627 RNIVEAAKKGTI-KVTLAKCKCTNpdCKVSSFKALCPVCGSRTEL----------------------------------- 670  Metha...
WP_013413924          582 RNIVEAAKKVNI-TVEISRRRCKK--CKINSFRSVCPYCKSKTEL----------------------------------- 623  Metha...
6HMS_B                742 qaegynyT----CPKCNVKLRPYAKRKIRPSELLNRAMENVKV--YGVDKLKGVMGMTSGWKMPEPLEKGLLRAKNDVYV 815 
Q74N29                763 -------EavthSKNNCREPKRYSLIKLNIKHYVDRAVQKLKLf-NIPKLVKGVRGTSNKDHIVERLEKAFLRSVSDVYV 834  Nanoa...
WP_012310170          650 -------H-------PNAEPVPYRSVKLNIREEVDRALRKLGEspGILERVKGVKGLTSGSKIPEPIEKGILRAKHGLSV 715  Candi...
BAJ47018              676 ------------CDKCGEDVVFSAKQVVDLRAELSAALQKIGE--SAPPRLSGVKGLTSRVKAPESFLKGLLRARYGLYV 741  Candi...
goetting:Ngar_c35970  674 -------K----CARCGKEGRTYSSTNYPLKAAIEHAKKKLGV--APEEPFKGVKSLMSRHRSAEPLEKGILRQKHGLHA 740  Candi...
A0RYM0                661 ------------CERCGRPGLAHSRVEFPLKKMLVSAQEKTGV--RAHDPLKGVKELAHQDRIAEPLEKGLIRQSRSLTV 726  Cenar...
agres:mru_0240        740 --------------------TKASQKDINLSTMLSKASNNIGV--RKVDEVKGVIGLISEDKLPEPLEKGILRAKNGVFT 797  Metha...
NZAGRC:Abm4_0155      676 --------------------GKTGVKNINLGRMLKKASDNVGV--RKVDEIKGVVGMISENKIPEPLEKGILRAKNEVFT 733  Metha...
Q2NHG2                671 --------------------ESSAAKNIKLDKLLMDAFENVNV--RRLDEVKGVKGLISEDKYPEPLEKGILRARNDVFT 728  Metha...
WP_013413924          624 --------------------LNPKKRKINIKSMLERAYKNTNT--RGLDEIKGVEGMISSKKLPEALEKGILRAKNGVST 681  Metha...
6HMS_B                816 FKDGTIRFDATDAPITHFRPRE-IGVSVEKLRELGYTHDFEGKPLVSEDQIVELKPQDIILS----------------KE 878 
Q74N29                835 NKDGTIRYDGTQIPLTHFRPKDlIGVTIEKLKELGYTHDIYGNPLEREDQILQLKPQDIILPygilvksrlnknkivrTD 914  Nanoa...
WP_012310170          716 FKDGTVRFDAVNAVLTHFKPEE-IGVSVEKLRELGYLEDVEGKYLEREDQLLELKVQDIIIP----------------RA 778  Candi...
BAJ47018              742 YKDGTVRFDATNAPLTHFTPRQ-IGVSVERLRSLGYLHDVFGNPLVSDEQVLELKPQDIILS----------------RK 804  Candi...
goetting:Ngar_c35970  741 FKDGTIRFDATNEPLTHFKPAW-ISVSIEKLRELGYTRDYLGKELVSPDQIVELMMQDVIIP----------------ID 803  Candi...
A0RYM0                727 FKDGTVRFDATNSPMTHFKPSW-IGTSAEKLRELGYETDVDGKKLEGPDQLVELRMQDIVIP----------------LE 789  Cenar...
agres:mru_0240        798 FKEGTIRHDSTDLPLTHFIPRE-IGVTVPKLIEMGYTHDCYGQEIVSDDQIIELKVQDIVVS----------------DN 860  Metha...
NZAGRC:Abm4_0155      734 FKDATIRHDSTDLPLTHFIPRE-VGVSVDKLLEMGYTEDCYGQPIENEEQIIELKVQDVVIS----------------EK 796  Metha...
Q2NHG2                729 YRDGTIRHDSTDLPLTHFIPRE-VGVPYEKILEMGYTEDIYGKPITNDNQIIEIKIQDIVVS----------------ES 791  Metha...
WP_013413924          682 FKDGTIRHDSTNLPLTHFTPKE-IGVDIEKLKELGYKKDCYGRDLVSDDQILELKVQDIIIS----------------ED 744  Metha...
6HMS_B                879 AGRYLLKVAKFVDDLLEKFYGLPRFYNAEKMEDLIGHLVIGLAPHTSAGIVGRIIGFVDALVGYAHPYFHAAKRRN 954 
Q74N29                915 AAEAFKKVANFVDEELKRLYNLEPYYNIEKAEDLIGKIVFGIAPHTSAAVVGRIIGFTPIQGIIAHPIWHAGQRRN 990  Nanoarcha...
WP_012310170          779 AAKYLLSIANYIDELLVKFYGLEPFYNLRDESDLIGQLVLTISPHTFVANLARIIGFTNADVIFAHPFLHAAKRRN 854  Candidatu...
BAJ47018              805 AAEHLVKVSRYIDDLL-KHAGLEKLYNLRDIGDLVGQLVVGLSPHTYVGVVARVIGMLDADLNFAHPVFHAAKRRd 879  Candidatu...
goetting:Ngar_c35970  804 SARHLVNTAKFIDEELAKLYELEPFYNVNSVEDLVGHLVVGLAPHTSVGIMGRIIGFTDSQVCLASPVWHSAKRRd 879  Candidatu...
A0RYM0                790 GAKYLVSACGYIDAELDKLYGAPPFYKVPDLGGLIGHLVVGLAPHTSVGVAARIIGYTETHVCFGTPNWHSAKRRd 865  Cenarchae...
agres:mru_0240        861 CGDYLVGVANFVDDLLEKYYGMDRFYNVEDKYDLIGHLIAGLAPHTSAGVLGRIVGFTKALGCYAHPYFHSAKRRN 936  Methanobr...
NZAGRC:Abm4_0155      797 CADYLVNVSHYVDDELTKFYHMDAFYNVKKREDLIGHLIAGLAPHTSAGVLGRIVGFTKALGCYAHPYFHSSKRRN 872  Methanobr...
Q2NHG2                792 CGDYLLKVSKFIDDLLIRYYHMEPFYNAENRVDLVGHLIAGLAPHTSAGVLGRIVGFTKASCCYAHPYFHSAKRRN 867  Methanosp...
WP_013413924          745 CASYLMKVANFVDDLLEKYYGLPRFYNVKKKEDLVGHLVAALAPHTSAAIVGRIIGFTKASACYAHPYFHAAKRRN 820  Methanoth...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap