Conserved Protein Domain Family
NicO

?
pfam03824: NicO 
High-affinity nickel-transport protein
High affinity nickel transporters involved in the incorporation of nickel into H2-uptake hydrogenase and urease enzymes. Essential for the expression of catalytically active hydrogenase and urease. Ion uptake is dependent on proton motive force. HoxN in Alcaligenes eutrophus is thought to be an integral membrane protein with seven transmembrane helices. The family also includes a cobalt transporter.
Statistics
?
PSSM-Id: 397758
Aligned: 13 rows
Threshold Bit Score: 187.168
Threshold Setting Gi: 3025266
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9HJ06              40 LSLGILSYFFGVRHGFDADHLAAIDNATRKLMQEGKKSRYTGLMFSLGHSTVVILLSLMLMVSIRITENa----MPKLEQ 115 Thermopla...
WGS:CP00:RVBD_2856  64 IGVGLTAYTLGLRHAFDADHIAAIDNTTRKLMSDGHRPLAVGFFFSLGHSTVVFGLAVMLVTGLKAIVGpvendSSTLHH 143 Mycobacte...
Q2FUR9              40 FGMGILAYTLGLRHAFDADHIAAIDNTVRKLLQQRKDPSGVGFYFSIGHSSVVFLMAVFLGVSVKWAKDe----LPHFQD 115 Staphyloc...
Q48262              31 YAAASMAYMLGAKHAFDADHIACIDNTIRKLTQQGKNAYGVGFYFSMGHSSVVILMTIISAFAIAWAKEh----TPMLEE 106 Helicobac...
Q97ZB2              78 ITLGVLSYTFGLRHAVDADHLAAIDNVTRKMLQEGKNPVFVGTFFSFGHSTVVILLSLAVMMASRLVTNs----LPSLEN 153 Saccharol...
P23516              49 LGTALLAYGLGLRHAVDADHLAAIDNVTRKLMQDGRRPITAGLWFSLGHSSVVVLASVLIAVMATTLQEr----LDAFHE 124 Cupriavid...
P76425              14 WFFIPSAILLGALHGLEPGHSKTM---MAAFIIAIKGTIKQAVMLGLAATISHTAVVWLIAFGGMVISK-------RFTA 83  Escherich...
Q9CNK2              58 MWLIAISFLYGVFHAIGPGHGKFI---IATYLSTHQTQLKTSMKLTFLSSLVQGGVAVCLTSFVVVILN-----LSSAYF 129 Pasteurel...
Q2YIN1              75 WGLVGLSFIYGIFHAVGPGHGKAV---ISSYMIANETALRRGIFLSFISSLLQAIMAVAVVGLAWLVLR-----GTGISM 146 Brucella ...
Q92LY4              79 WSLIGLSFTYGVFHAAGPGHGKAV---ISSYMIANETELKRGVLLSFLSSILQGVVAILLIGAVYLVLR-----GSSISM 150 Sinorhizo...
Q45247              67 MATALLAWVFGLRHAVDADHIAAIDNVVRSLMQTGGTPRSAGLYFALGHSSVVVVATMLLALGVVSLGG-----DGLLKE 141 Bradyrhiz...
Q9FA48              38 LSAAILAYSFGLRHAVDADHIAAIDTVTRKLMQQGKTPLGVGAFFSLGHSTIVVLACLAIVVTSMAFRDr----IDVLHQ 113 Salmonell...
WP_010973904        76 GSLIGLSFAYGVFHAAGPGHGKAV---ISSYMIANETQLRRGILISFVSALIQGLMAIGLVGAAWLVLR-----GTSITM 147 Agrobacte...
Q9HJ06             116 IGTIVGTLVSGLFLFLLGTMNLFVLIELRKAYEASIR----DAISDGDLEDILSKR---------GFMNRYLGK-----L 177 Thermopla...
WGS:CP00:RVBD_2856 144 YTGLIGTSISGAFLYLIGILNVIVLVGIVRVFAHLRR----GDYDEAELEQQLDNR---------GLLIRFLGR-----F 205 Mycobacte...
Q2FUR9             116 IGGTIGTLVSGFFLVLIGVLNLIILISLINLFAKLRR----EHIEEAEVDALLESR---------GLVSRFVGP-----Y 177 Staphyloc...
Q48262             107 IGGVVGTLVSGLFLLIIGLLNAIILLDLLKIFKKSHSneslSQQQNEEIERLLTSR---------GLLNRFFKP-----L 172 Helicobac...
Q97ZB2             154 TGNLIETLISGGFLYLLGLLNTIVFYELYSFYKEGKY----DKQ---KLEEILQKR---------GFMNKYFNK-----L 212 Saccharol...
P23516             125 VGSVIGTLASALFLFAIAAINLVILRSAYRAFRRVRRg---GIYVEEDFDLLFGNR---------GFLARIFRP-----L 187 Cupriavid...
P76425              84 QSAEPWLQL-ISAVIIISTAFWMFWRTWRGERNWLEN------MHGHDYEHHHHDHe--------HHHDHG--------- 139 Escherich...
Q9CNK2             130 KLSQLWLER-IAFLLLLCLGITWCYQNGRKLYLDYVK----TRQNSPLKIYTLQFD---------HSPSKIGQP------ 189 Pasteurel...
Q2YIN1             147 NQTAHYMEI-ASFALVLFFGLWLLVRKLPQLFRKRDHa---GAGPASPLFAAAPQPaivsgpawqGSISQATRTaatssT 222 Brucella ...
Q92LY4             151 TNATRALEI-ASYALIAAFGGWLVFRKLRSMl---------RPAPAPATVHAHDG----------HSHGHEH-------- 202 Sinorhizo...
Q45247             142 IGSFIGASVSALFLLVIAAINLAIFASLWRTFRKAREq---GIRDAAGLDALLAHR---------GILVRLLGP-----M 204 Bradyrhiz...
Q9FA48             114 YGSLIGTAVSAFFLLAMALLNLFILFNVWRQFRSVTR----GESVRAHDEAIPG-----------GLMTRIFQR-----T 173 Salmonell...
WP_010973904       148 TKATQAMEI-ASFAMVALFGAWLLVRKLWSLRi--------RREPVPVFATAGEAPa-------aRTNGMGTG------- 204 Agrobacte...
Q9HJ06             178 FRIIKSQYYMYPIGFLFGLGFDTASETTLLAISAAtaGVFNTIPIYSLLVFPFLFTAGMVLTDSSDGFFMNSAYGWAFTG 257 Thermopla...
WGS:CP00:RVBD_2856 206 TKSLTKSWHMYPVGFLFGLGFDTATEIALLVLAGT--SAAAGLPWYAILCLPVLFAAGMCLLDTIDGSFMNFAYGWAFSS 283 Mycobacte...
Q2FUR9             178 FKLITRSWHVLPLGFLFGLGFDTASEIALLALSSG--ASQQAISFIGILSLPILFASGMSLLDTLDGVVMKYAYNWAFFN 255 Staphyloc...
Q48262             173 FNFVSKSWHIYPIGFLFGLGFDTASEIALLALSSS---AI-KVSMVGMLSLPILFAAGMSLFDTLDGAFMLKAYDWAFKT 248 Helicobac...
Q97ZB2             213 FKIITNQWQMYIVGFLFGLGFDTATEVAILSISAIlsSTYIHIPIYIILLYPILFSLGMSLVDTTDGLFMRFAYGWAFLS 292 Saccharol...
P23516             188 FRFITRSWHMYPLGMLFALGFDTATEVALLGISTM--EASRGVPIWSILVFPALFTAGMALIDTIDSILMCGAYAWAYAK 265 Cupriavid...
P76425             140 ------HHHHHEHG------EYQDAHARAHANDIK--RRFDGREVTNWQILLFGLTGGLIPCPAAITVLLICIQLKALTL 205 Escherich...
Q9CNK2             190 -RVEQTHTHSIACG--------CGHQ---HAPNPS---QL-TQARDWKSQLLVIFSIGMRPCSGAIFILFLAYMLDLYFW 253 Pasteurel...
Q2YIN1             223 VKLNYKPATAATDHIFIGEGDVCAACGNAHIVDPS---TL-GDDFNWKTAWSAIFSVGLRPCSGALIVLTFALLNGLMVG 298 Brucella ...
Q92LY4             203 -HHHDHHHAHGHAH---GPGEVCATCGHAHAPDPA---LLKGDRFALSEAWSAIVAVGLRPCSGALIVLSFALLNGLYLG 275 Sinorhizo...
Q45247             205 FRLVTKPWHMYPLGFLFGLGFDTATEIGLLSISAS--EAARGASLADVMVFPALFAAGMALVDTADSTLMVSAYRWAFVD 282 Bradyrhiz...
Q9FA48             174 FRLVTSSWHMYFVGFLFGLGFDTATEVGLLGISAS--AANQGLSLWSMMIFPVLFTAGMALVDSLDNFVMVGAYGWAFSH 251 Salmonell...
WP_010973904       205 LRFQGKPVFADHDHN--GTGDLCTACGKSHAPDPM---LLKGKNFSLHEAWSAIIAVGLRPCSGAIIVMSFALLNGLYLG 279 Agrobacte...
Q9HJ06             258 nPRKKLWFNLTMTSISITIAYVIGSLETLGLVQQEFDLSGS--IWHSIYIITdlaWGNVGLIIVAIFALSWIISYTR 332 Thermoplasma...
WGS:CP00:RVBD_2856 284 -PVRKIYYNITVTGLSVAVALLIGSVELLGLIANQLGWQGP--FWDWLGGLD---LNTVGFVVVAMFALTWAIALLV 354 Mycobacteriu...
Q2FUR9             256 -PIRKIYYNITITAISVMAALVIGMIELLQILADKLDLHGA--FWAFIGSIE---FDYLGYILVALFLITWLISSLi 326 Staphylococc...
Q48262             249 -PLRKIYYNISITALSVFIALFIGLIELFQVVSEKLHLKFEnrLLRALQSLE---FTDLGYYLVGLFVIAFLGSFfl 321 Helicobacter...
Q97ZB2             293 -PLRKIWYNLTITLISILIAFGIGTIELLGLLQAEFNLTGL--FWDQIAALNnvyWETIGYYVILTFAITWIGSG-M 365 Saccharolobu...
P23516             266 -PVRKLYYNMTITFVSAIVALIVGGIETLGLLADKFMLKGV--FWNAVGALNe-nFCQLGFVIIGIFTVCWVVSIVV 338 Cupriavidus ...
P76425             206 --GATLVVSFSIGLALTLVTVGVGAAISVQQVAKRWSGFNT--LAKRAPYFS---SLLIGLVGVYMGVHGFMGIMR- 274 Escherichia ...
Q9CNK2             254 --GIIATFAMAV-GTGMTLSGFALIVLYARNTAMKVGKWYQfsPTAQQRWGRl--LKLVAGILLIFFATSLLYGTTI 325 Pasteurella ...
Q2YIN1             299 --GLLSVFAMAL-GTFITVAVLATLAVTAKNTALRFAGSKA---MSGRLKAA---IEVCAALFITLTGALLLSAALV 366 Brucella abo...
Q92LY4             276 --GVLSVFAMSI-GTAITVSILATMAVTAKGIAVRYASSDS---AAARISNG---IEIAGALLVLLLGLVLLGAALQ 343 Sinorhizobiu...
Q45247             283 -PMRKLWYNLTITGASVAVALFIGGIEALGLIGNRLDLSGG--VWTLIDALNe-sLANVGLAVIALFAIAWLLSIVL 355 Bradyrhizobi...
Q9FA48             252 -PLRKLYYNMTITAASVIVALAIGGLEALGLIDDALQLSGT--FWQTVSTLNd-hMGNVGFWVVGAFVLfwllsvln 324 Salmonella e...
WP_010973904       280 --GVLSVLAMSL-GTAITVSALAIMAVSAKGLAVRFAGPGSr--KAAGISHA---IEIAGALFVLIMGLLLLGASLQ 348 Agrobacteriu...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap