Conserved Protein Domain Family
MadM

?
pfam03818: MadM 
Malonate/sodium symporter MadM subunit
Statistics
?
PSSM-Id: 397752
Aligned: 33 rows
Threshold Bit Score: 52.1703
Threshold Setting Gi: 81393126
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CeBiTec:A605_00560                   3 EILEKNSLVFAFAIVGVMMLVSRLISQKVTRGRVHGSAVAIIIGLGLAYIGGTYT 57  Corynebacterium ha...
Q9I6S2                               7 KVINGYGLISGFAIIGVTMAVSYWLSARLTRGRLHGSAIAIFLGLVLSYVGGVAT 61  Pseudomonas aerugi...
mgcchina:PST_4112                    7 KVITGYGLISGFAIIGATMWISYWLSDKLTKGRLHGSAVAILIGLLLSYIGGVVT 61  Pseudomonas stutze...
WGS:AAXU:1101174000282_ALPR1_10620   6 KVVDKNGLIVGFFCIGVLAFGSEILSKKFFQGKIPGSAIAIFLGLVLGYLGGLFT 60  Algoriphagus machi...
WP_013766159                         6 TVLVKNGLVVAFLVTGVVTYCSEYLSRVLTNKKIPGSAIAIFTGLVLAYIGGMVT 60  Haliscomenobacter ...
jgi:Emtol_0621                       6 KFFEKNGLIIAFLSVGIITYISGVFSDKLTRKKIPASAIAILIGLVLAYVGGIYT 60  Emticicia oligotro...
jgi:Runsl_2169                       6 KFLQKNGLVFAFLAVGVIIYLSGIISDKLTRRKIPASAIAILAGLVIAYFGGVYs 60  Runella slithyform...
Q4FSL0                               6 ATLTKNAFVTALAITGLVMFFSHILSKYLTNNKLQSSAIAIILGLVAAYFAGLYT 60  Psychrobacter arct...
CDB03256                             9 GILIDNAFIMSFMFIAGGVLLSSVISKYIFKGRLPASAVAIVIGLIAAYIGGRIT 63  Firmicutes bacteri...
CDA91762                             9 NIFINNAFVMSFLFIALGVFVSSVISKYIFKGKLPSSAVAIIVGLIAAYIGGIIT 63  Firmicutes bacteri...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap