5MRW


Conserved Protein Domain Family
KdpA

?
pfam03814: KdpA 
Click on image for an interactive view with Cn3D
Potassium-transporting ATPase A subunit
Statistics
?
PSSM-Id: 397748
Aligned: 221 rows
Threshold Bit Score: 530.846
Threshold Setting Gi: 505045407
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5MRW_A            11 TFLLVLMVLARPLGSGLAR-LINDIplp----------------gttGVERVLFRA-L---GVSd-REMNWKQYLCAILG 68  Escherichia...
EQB69755          30 LYLIIISFFGYMIAPYIKK-LYTGEntklr-------------kytdPIIGFIEKV-A---GVDrnKTYSFKGYFISLII 91  Thermoplasm...
EQB67403          29 IYLIVISIFGFIIADHIKK-IYLGQrtilt-------------gfseKAIYFIEKI-S---GVDenESHTFKGYFFSLLF 90  Thermoplasm...
P57685            29 IYLIIASVLAYILSFHIAK-IYLDEktvfs-------------kitgRIISFFERM-I---GESpdHGMTFKEYFINLLL 90  Thermoplasm...
Q6L2R0            24 IYIFLALLFGYLISNYISK-LYMDEedktwl-----------ypisgRVTNFFEKL-L---GEDknKKMKFKDYFLNLLI 87  Picrophilus...
EQB64627          12 VVWGTVIVLSWFLSSYLLG-VFTGRksrld-------------rilvPVENFIYLL-A---GIDssKNMGWKEYFKTLLY 73  Thermoplasm...
WP_015232509      10 IIVAISLMVSYLLSMPI-SyFIKYEkdlpn-------------tklnKIENFIFKT-L---GINkeNSMNYKEYLLSLLS 71  Caldisphaer...
CBRAS:TCELL_0356  11 nIFLVTVMTGYVLSGVIRKmVVEWHkk------------------ppRVLEVVYRC-LdriGLd-tTNKSFTDYAKDLLF 70  Thermogladi...
BAI62039          12 pIILLALILAIPLGEYLAL-VFSGKraple-------------pafsPIEKALSRLlM---GMDr-HPMDWKEYALSLLA 73  Methanocell...
P57684            12 VFFTILAVLVFVAGEYLAW-VYREQansdhrppgylswferldeiftPIENGLYRL-S---GINprREMTWKGYLKAVLV 86  Halobacteri...
5MRW_A            69 LNMLGLAVLFFMLLGQ-HYLPLNPQQLPGLSWDLALNTAVSFVTNTNWRSYSGETTLSYFSQMAGLTVQNFLSAASGIAV 147 Escherichia...
EQB69755          92 FNFVAGTISFLFLIFQ-GYFFKAPGQDVM-SPSLTFNTIISFLTNTNLQHYSSPTTLTYLDLTVVIIGLMFLSAGTGFAA 169 Thermoplasm...
EQB67403          91 FNLMAGVFTLFFLLIQtNYFPL-PGQRGF-SFSLAINTISSFLTNTNLQNYSSPQRLSYYELTIVIIGLMFLSAGTGFAA 168 Thermoplasm...
P57685            91 FNFFAGLISFLVIMFQ-KYLPFSYDTVGM-SPSLDFNTVVSFLTNTNLQHYSNPMRLSYFSQTFVITGLMFLSAGTGFAA 168 Thermoplasm...
Q6L2R0            88 FNAAAGVIAFIAIYFQ-RFFPFYDDNKMGLS--LTFNTVVSFLTNTDLEHFSNPLKLSIFSWTFSIMGLMFLSAATGFAA 164 Picrophilus...
EQB64627          74 LNAGEAILAFFILMFQ-QSLPLNPMHYSGMSWSLALNTVLSFSSNTNLQHYNGELTLSYLSQMSAIQFLQFTSAATGLAV 152 Thermoplasm...
WP_015232509      72 LNIIFIVFDTVFLMFQ-NHLSFIGPNYKGINFDLAFNTAVSFVTNTNLQHYIGETSLSLTSQMLVIITTMFIGPSTGLAT 150 Caldisphaer...
CBRAS:TCELL_0356  71 FNFILIAIDTVLLAKQ-G-LFFGGAD---LSWDLAFNTAVSFATNTNLQHYIGETTLTNMAQSVVIGSTMFLAPATGIAV 145 Thermogladi...
BAI62039          74 LNALLWAVAFAILYSA-G-----------MSPDLAFHTATSFVTNTDQQHYSGD-TLSPAAQMLALTMLMFASAATGISS 140 Methanocell...
P57684            87 FNVCIWVLLFVVLMFQ-DALPMNFVGVGGESWDLAFHTASSFTSNTNQQHYSGE-TLSVFTHTFGIGIAMFLTPATGLAL 164 Halobacteri...
5MRW_A           148 IFALIRAFtRQSmSTLGNAWVDLLRITLWVLVPVALLIALFFIQQGALQNFL-PYQa-VNTVE-GAQQLLPMGPVASQEA 224 Escherichia...
EQB69755         170 SMAFVRGImNDD-KKLGNFFHDFLVAIFDLILPLSLLATVLLIIVGVPDTTY-SSIiiHPFFG-KMTVNIPIGPVASLEG 246 Thermoplasm...
EQB67403         169 SMAFIRGIiKDD-GKLGNFFHDFLVAIFELILPLSLLATVIFLFIGIPETTS-SFLyiHPFFS-KSVIGIPIGPVASLEG 245 Thermoplasm...
P57685           169 SMAFVRGIrTDT-GNIGNFYHDFLVSIFDLILPLTVILTVILILAGIPETMQ-RYItvNAFLT-NKVYNIPLGPVATLEA 245 Thermoplasm...
Q6L2R0           165 SMAFVRGIrNDD-GFIGNFYHDFLVSLFYLIFPLSILGAVIFILAGVPETLR-AYIdvYPLFS-SGPEKLPLGPIATFIA 241 Picrophilus...
EQB64627         153 GVAVIRGFaGKA-RTIGNFYYDYVRSLTRVLLPLAFIATIILIFMGVPQALS-GYPt-VSTLQkGATEILYKGPVASLVS 229 Thermoplasm...
WP_015232509     151 SFAFIRGFiRRG-KHLGNFYVDFMRSLIFLILPLSIISAILLIFMGVPQNLNpFYE--INSFS---HQIIYSGPVASLES 224 Caldisphaer...
CBRAS:TCELL_0356 146 SLAFLRSLi--G-ESAGNFYRDLVMAVGLLLLPLSIVSAVLLSVLGVPQTFN-EWIrvDNPYS-G-SFMLRLGPVASFEA 219 Thermogladi...
BAI62039         141 AFALIRGLlATD-GKLGNFFSDFIKCIVRVLLPGAFMVAIVFVACGIPQTLG-GSLd-VKTIT-GLMQSIPLGPVASLES 216 Methanocell...
P57684           165 MPAFARAFtNKEdPRLGNFYENVVRGLVRFLLPISLLIAIILMAEGSVQTILgGQLt-ANTFT-MGIQNIRIGPHAGIEA 242 Halobacteri...
5MRW_A           225 IKMLGTNGGGFFNANSSHPFENPTALTNFVQMLAIFLIPTALCFAFGEVMGDRRQGRMLLWAMSVIFVICVGVVMWAEVQ 304 Escherichia...
EQB69755         247 IKNIGTNGGGFYGANAGYPFENPDWISNLIEVVSFTIIPIGSIFALGQALNNRKFGRVIYGVIVALFIFSALLTFFGEIS 326 Thermoplasm...
EQB67403         246 IKNIGTNGGGFYGANAGYPFENPNWISNIVEVVSFTIIPMGSIFALGRVLESRNFGRMVFGVIMSLFMLSAFFTFFGEYA 325 Thermoplasm...
P57685           246 IKNIGTNGGGFYGANAAYPFENPDWFTNLVEFVSFVIIPLASLISLGIVFGDRKFGRMLYWVVMFFFIFDALFAFFGEFA 325 Thermoplasm...
Q6L2R0           242 IKYVGTNGGGIYGANAAYPLGNPNWFTNIVSYILFIIIPTGSIMALGRVFIKR-FANMLVYVLFTIFAITSLMTYLSEFI 320 Picrophilus...
EQB64627         230 IMQLGTNGGGYFGANSAYPLQNPSQLSDLFEIGMMMFIPTSLLFLFGRMVGDNREGRTLFLAAYAIYGIDLLIAFLSTTV 309 Thermoplasm...
WP_015232509     225 IKFLGNNGGGFFGSNSANILENPSNLSNYFEMFLMLIFPLSIPLAFGRILGKKR-GYTLLATILISMIITILIA---EII 300 Caldisphaer...
CBRAS:TCELL_0356 220 IKLLGTNGGGFYGSNSAYPLENPSGLTNFIESVLMLLIPTSMLFAFGRVLGKRR-GLSLFAVAYVTAFIIVGVSVASG-- 296 Thermogladi...
BAI62039         217 IKYLGTNGGGYYGANSAHPFENPSPLTNVIQNILALLIPFSIPYAFGIMAGKRRQGAIILIAMLVIFVTGAALMLAGEGW 296 Methanocell...
P57684           243 IKMFGTNGGGINAANAATAFENPTPLSNLVLTLAMPIGTFSAIYAWGAWVGNRSHGVAIVAAFFVIYMALTGVAVVGETG 322 Halobacteri...
5MRW_A           305 GNPH-LLAlg----tdSSINMEGKESRFGVLVSSLFAVVTTAASCGAVIAMHDSFTALGGMVPMWLMQIgEVVFGGVGSG 379 Escherichia...
EQB69755         327 GIPA-MANlgf----nygGNFIGKETAIGISQSSIFSTGATLTSTGAANSALIDYTPAGILGILFPLLL-NDPLGGVGTG 400 Thermoplasm...
EQB67403         326 GLPT-MSNlgl----fytGNFLGKEIALGISQTSIFASGATMTSTGATNSALNAFTPAGILGVLFPMLL-NDPLGGVGTG 399 Thermoplasm...
P57685           326 GVPF-L-Hlgy-----ytGNMVGKETAIGISQSTIFAVGATITSTGASNAALVSYTPAGIIGVLIGLLL-NDPLGGVGTG 397 Thermoplasm...
Q6L2R0           321 GIPE-ISAlgs-----ysGNMIGKEVYLGLAPTVMFQVGSVFTSTGAASGSIISYTPVGILGLLINLVL-NDPLGGVGTG 393 Picrophilus...
EQB64627         310 -----IGR--------------GLEVRIGGVASTLWTVTTTAFTTGSLNASLSGFNPVVILTAFFGMLI-QAAPGGVGVG 369 Thermoplasm...
WP_015232509     301 -KPVgIVS-----------------YRFGNYSAVLFNTFSMLTNTGAVDTSLAAMSYSAIIAFLFSMFI-QSIPGAIGVG 361 Caldisphaer...
CBRAS:TCELL_0356 297 -VPP-LNS--------------LVEPRLGYPGSLVFNTASLLSDTGATASSLLAMKPSAIVAFLTAMFI-QAVPGADGVG 359 Thermogladi...
BAI62039         297 -NPAlpl-------nyPDGYLEGKEQRFTAYETTFFLAVDTFVQSGGTSGSVTSMMPDAILGAMSGMMM-QCTPGGVGAG 367 Methanocell...
P57684           323 TNAGmVVTgnglhvdqTVGNMEGKETRFGPTASAIWGLSTTGTTNGGVNSMHNSWTALGAFSLLFAFAT-NNISNGVGTG 401 Halobacteri...
5MRW_A           380 LYGMMLFVLLAVFIAGLMIGRTPEYLGKKIDVREMKLTALAILVTPTLVLMGAALAMMT-DaGRSA-MLNPGPHGFSEVL 457 Escherichia...
EQB69755         401 ILNIFSYVIFTVFIVSLMVGKLPEIMSLKVSAKEMKYSTYSLITHPLIIIVPLGIVLLLsP-ILMSsFVNTRPDQITQLL 479 Thermoplasm...
EQB67403         400 ILNIFTYVIFTIFLVALMVGKLPELFSLKISSKEIKYSTYSLITHPLLIVVPLGITLLI-P-ALMSsFVSPRPDQITELL 477 Thermoplasm...
P57685           398 VLNIFMYIIFTVFIASLMVGKLPEIMSLRISSKEIKYSTLSLITHPLLVVIPLGITLMI-P-HLMSsFVNPESSRITELL 475 Thermoplasm...
Q6L2R0           394 VINIFTYVIFTVFISSLMVGKLPEIMSIRIGSREMKYSTIALLSHPLIVLIPLGVTLLI-P-GVMEtFLNGHASNITNLL 471 Picrophilus...
EQB64627         370 AMYLIMYVIVTIFLVGLMAGRTPEYLGVKIEGSDVKLAVAAFLTHPIIILVPTVVAFAIgA-ESTV-GLAANATGFTRIF 447 Thermoplasm...
WP_015232509     362 FMYLIVYVLLTLFILGLMVGKMPEFIGMKISPRDVKLSVMVFLTHPLIILIPTALALTMgY-AYHI-FGSINSYTYTEVL 439 Caldisphaer...
CBRAS:TCELL_0356 360 LLYLLVYVFIIIFIGSLMVGKTPRFINIPISPRVVKLSTVIFLIHPAIILVPTSIALVLrQ-YTAF-SNRLDPLTYTMVL 437 Thermogladi...
BAI62039         368 FDVMLVFILLSVFIAGLMVGRTPEFLGKKVEPNEMKLVALVIIIHPILVLLPTALTIIV-N-P-HA-ALNPGPRGFSEIM 443 Methanocell...
P57684           402 LLNILMFVILTAFIGALMIGRRPQYLGKKLEWQEMRYVFVVILVLPILVLIPQAAAVVY-Q-GAIDsMNNPGFRGFSEVL 479 Halobacteri...
5MRW_A           458 YAVSSAANNNGSAFAGLSANSPFWNCLLAFCMFVGRFGVIIPVMAIAGSLVSKKSQA-ASSGTLPTHGPLFVGLLIGTVL 536 Escherichia...
EQB69755         480 YEFASAASNNGSEVGGFATNTAFFNIIDGIIMLMGRFPIMAFQLVIAQSFASKKPKV-LYGRTFDIGSFWFGMMLFFTML 558 Thermoplasm...
EQB67403         478 YEFSSAAANNGSAMGGFQVNQAFFNILEAGIMLTGRFLVMGFQLMIAQSFAFKKPKV-TYGRSVNVGSFWFGFMLFFTMI 556 Thermoplasm...
P57685           476 YEFASAASNNGSEMGGFITNQPFFNYLDGVLMLLGRYLLMAFQLIIAQSFSVKKAKA-QYYRSIDTSNWIFGVLLIAAMI 554 Thermoplasm...
Q6L2R0           472 YEFASAASNNGSEAGGFLTDSNYFNYLDGIIMLLGRYLILGIQLLLAQQFAFKKPKSeYTRATIDIGSPAFGFMLFAVII 551 Picrophilus...
EQB64627         448 YEFTSAAANNGSDYLGAAGNTVFFNVATGIVMWVGRFLPILFMLAIADGVSTRKR---SQKQGLKTGSISFVVILVFSIF 524 Thermoplasm...
WP_015232509     440 YEFTSAAANNGSSYLGNIGNTIFFNISTAIVMLLGRYLPIGLMLAISQSFAMKERK--RGPEPLPTEGLLFLAVLIFMIF 517 Caldisphaer...
CBRAS:TCELL_0356 438 YEYTSAAANNGSGYLGPLGNTVFWNLSTAIVMLLGRYLPIFLFLLIADDISKAKRS--VAEEPVETQGLLFVVFSVVMIL 515 Thermogladi...
BAI62039         444 YEFLSASANNGSGMAGLANTTPYFNILSGLMIATGRYVPLVAMIAIAGLLSRKKPIE-ATTGTLPTDNPTFLLFLIGIIV 522 Methanocell...
P57684           480 YEFFSASANNGSGFEGLGDGTLFFNLVNGVQVLLARYVPITAQLAIAGYLANKKVSP-ESKGSLDTDTPAFVGLLIGVII 558 Halobacteri...
5MRW_A           537 LVGALTFIPALALGPVAEYL 556 Escherichia coli
EQB69755         559 LLGLLSFFPILAVGPLLswg 578 Thermoplasmatales archaeon Gpl
EQB67403         557 LLGLLSFFPVLALGPLLawg 576 Thermoplasmatales archaeon E-plasma
P57685           555 LIGLLSYFPIIVLGPLLswa 574 Thermoplasma acidophilum DSM 1728
Q6L2R0           552 MIGLLSYLPVFALGPLyswa 571 Picrophilus torridus
EQB64627         525 ILTVLTFFPFLVLGPVLQFL 544 Thermoplasmatales archaeon I-plasma
WP_015232509     518 LLVILTFIPFVIIGPLsw-- 535 Caldisphaera lagunensis
CBRAS:TCELL_0356 516 ILTALTFFPFLAIGPLlmgg 535 Thermogladius calderae 1633
BAI62039         523 IVGAITFLPVLTFGPLAELL 542 Methanocella paludicola SANAE
P57684           559 IVSALVFLPALVFGPIGELL 578 Halobacterium salinarum NRC-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap