4L6U


Conserved Protein Domain Family
RAMPs

?
pfam03787: RAMPs 
Click on image for an interactive view with Cn3D
RAMP superfamily
The molecular function of these proteins is not yet known. However, they have been identified and called the RAMP (Repair Associated Mysterious Proteins) superfamily. The members of this family have no known function they are around 300 amino acids in length and have several conserved motifs.
Statistics
?
PSSM-Id: 397727
Aligned: 147 rows
Threshold Bit Score: 35.7647
Threshold Setting Gi: 122413398
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4L6U_B            9 TLEAITP-VFMRGA------------------------------------NQSKAEIRAASIKGLMRWWFR--------- 42  Archaeoglobu...
Q7MTH6           59 ELKTCYPgLLCGVGyhheinkpadekgkkvegdkeddapevynlgmyfdyTSGLPVIPGSSIKGMLRSAIE--------- 129 Porphyromona...
WP_015942495     99 NFELLTP-WYSKDDrvfhlld----------------------npvrkdrVFGVPFMAASSWKGMLRWVCR--------- 146 Chloroflexus...
ABP66126         51 DIETKTP-IFIRGEgsq------------------------------ffkINNKPFIPGSSLRGMIRTLLEivsfgkfsf 99  Caldicellulo...
Q6ZED5          156 KLTTVTP-LLIPDAskeeinnnh-------------------ktypvrigKDGKPYLPPTSIKGMLRSAYE--------- 206 Synechocysti...
mbdal:THA_859     8 KFKTLSP-LWTGNY------------------------------------RGITNEIRPSSLIGSLRFWLD--------- 41  Thermosipho ...
Q0ATZ2          170 NIEALTP-LYIRDAykqdeekrtyeak----------irdekwenpeffsPGGTPKIPGSSLRGMVRNLLEivscsqlky 238 Syntrophomon...
jgi:Teth39_0923 133 FLTTKTP-IYIRRDkeesd---------------------------ffsiKNGLPIIPGSSLRGMVRNLVEivsfgkfef 184 Thermoanaero...
Q2FL77          279 IVTCITDfSMKGLDept-------------------------------vtNGLGPVIPGSTIKGFLRHKLEq-------- 319 Methanospiri...
WP_011986670     73 YFKTTYPgLIVGTGyshilkekee-----------------fklslefdyTTGLPVINGSSIKGMLRSVFY--------- 126 Clostridium ...
4L6U_B           43 ---------ALSG--------------------------SYFGNDVEGLR-R---------------------------- 58  Archaeoglobu...
Q7MTH6          130 ---------EWDFl-------------------------ADYELNNGVTReE---------------------------- 147 Porphyromona...
WP_015942495    147 ---------MQAGl-------------------------REHLEKQGGKMdDwrd------------------------- 167 Chloroflexus...
ABP66126        100 cdigrklfyRAVGd-------------------------LSSLGKE-YRSlFtnqqd----------------------- 130 Caldicellulo...
Q6ZED5          207 ---------AVTNs-------------------------RLAVFEDHDSRlAyrmpatmglqmvpariegdnivlypgts 252 Synechocysti...
mbdal:THA_859    42 ---------IIcyfsglq---------------indlgsFDPEKFQNFIL-Kegtdfesln------------------- 77  Thermosipho ...
Q0ATZ2          239 vedkrfyyrKVAVpgryqtlmikgsknrdglrpateagwLKKEKGKYYIYpLekqqvyridakvsgdswkvvmkddedke 318 Syntrophomon...
jgi:Teth39_0923 185 fdkdkrlyyRDVAg-------------------------KKSNLKDIYSSkIskdrikagyliydqrkykiipseydrfq 239 Thermoanaero...
Q2FL77          320 ---------------------------------------RETDKK----------------------------------- 325 Methanospiri...
WP_011986670    127 ---------NKKDd-------------------------EKLIEEKEKYIrDilkelikkenp----------------- 155 Clostridium ...
4L6U_B              --------------------------------------------------------------------------------     Archaeoglobu...
Q7MTH6              --------------------------------------------------------------------------------     Porphyromona...
WP_015942495        --------------------------------------------------------------------------------     Chloroflexus...
ABP66126            --------------------------------------------------------------------------------     Caldicellulo...
Q6ZED5          253 rignngrpanndpmyaaw-------------------------------------------------------------- 270 Synechocysti...
mbdal:THA_859       --------------------------------------------------------------------------------     Thermosipho ...
Q0ATZ2          319 ysqelakfdfypvsfipakekahphrggkirlsyaliinnsleighekaeldsnykkgylvlsgsmgrnkhmhpvihgpk 398 Syntrophomon...
jgi:Teth39_0923 240 dtskefmiekynndykvwsgrmqkkrknwimksisnsgdfieltendikdyks--------------------------- 292 Thermoanaero...
Q2FL77              --------------------------------------------------------------------------------     Methanospiri...
WP_011986670        --------------------------------------------------------------------------------     Clostridium ...
4L6U_B              --------------------------------------------------------------------------------     Archaeoglobu...
Q7MTH6              --------------------------------------------------------------------------------     Porphyromona...
WP_015942495        --------------------------------------------------------------------------------     Chloroflexus...
ABP66126        131 -----------------------------------------------------------------------------cys 133 Caldicellulo...
Q6ZED5          271 ------------------------------------lpyyqnriaydgsrdyqmaehgdhvrfwaerytrgnfcywrvrq 314 Synechocysti...
mbdal:THA_859    78 -------------------------------------------------------------------------kifsefr 84  Thermosipho ...
Q0ATZ2          399 degrveidqdliesyiadisrepkadlfkmlekypggipcfylidnkgniksightplfrlaydkkvkdhlpaehksntv 478 Syntrophomon...
jgi:Teth39_0923 293 -dinrnipeyydilkmakdkkvtlpnkivelpngvpvfyveyndkkgnkkiafghtgffrlpyeltigdhvpenlksddi 371 Thermoanaero...
Q2FL77              --------------------------------------------------------------------------------     Methanospiri...
WP_011986670    156 ------------------------------------------------------------------------kfngefdf 163 Clostridium ...
4L6U_B           59 --VEEYVF-----GST--------------------------------KRESRVVVEVvkehveer-------------- 85  Archaeoglobu...
Q7MTH6          148 --IIEKVFv----GKEy-------------------------------SIYDRDIFLDaipirvdntlfg---------- 180 Porphyromona...
WP_015942495    168 pdWILHLF-----GNEkge--------------------------geeFSRGALVLYPtwfdkigfevin---------- 206 Chloroflexus...
ABP66126        134 ykFRAGIL-----KREng----------------------------iyKIYPSKEIEGtqifrveettikysdlpeelkn 180 Caldicellulo...
Q6ZED5          315 iaRHNQNL-----GNRpergrnygqhhstgvieqfegfvyktnknignKHDERVFIIDresieiplsrdlrrkwrelits 389 Synechocysti...
mbdal:THA_859    85 lsLSSKIF-----GCN--------------------------------KWEGWIRIKEikpvgkycfgnylnl------- 120 Thermosipho ...
Q0ATZ2          479 idFTEAIF-----GNAd-------------------------------KFAGRVFFEDarivnnpgqyqelspqilstpk 522 Syntrophomon...
jgi:Teth39_0923 372 tdFAEAIF-----GKEs-------------------------------KWASRVFFEDavldkgqgdifveeaspkilas 415 Thermoanaero...
Q2FL77          326 --IIDSIF-----GGL--------------------------------NQRGRLIVSDawyag----------------- 349 Methanospiri...
WP_011986670    164 eeLTNNIFegkckAKDkng--------------------------ihmSISERDIFLGatidieati------------- 204 Clostridium ...
4L6U_B              --------------------------------------------------------------------------------     Archaeoglobu...
Q7MTH6              --------------------------------------------------------------------------------     Porphyromona...
WP_015942495        --------------------------------------------------------------------------------     Chloroflexus...
ABP66126        181 sppys--------------------------------------------------------------------------- 185 Caldicellulo...
Q6ZED5          390 yqeihkkevdrgdtgpsavngavwsrqiiadesernlsdgtlcyahvkkedgqykilnlypvmitrglyeiapvdlldet 469 Synechocysti...
mbdal:THA_859       --------------------------------------------------------------------------------     Thermosipho ...
Q0ATZ2          523 p------------------------------------------------------------------------------- 523 Syntrophomon...
jgi:Teth39_0923 416 pkptafqlyleqpdgentkltdik-------------------------------------------------hwdnedt 446 Thermoanaero...
Q2FL77              --------------------------------------------------------------------------------     Methanospiri...
WP_011986670        --------------------------------------------------------------------------------     Clostridium ...
4L6U_B           86 ------------------------------fcplpmvwKKKKGVTTRVSQRaiapg----------skftLLLTSDD--- 122 Archaeoglobu...
Q7MTH6          181 --------------------------edyithhpnplqNPNPVRFLRVEPGvt---------------yqFRFILKDhg- 218 Porphyromona...
WP_015942495    207 --------------------------phsrerragtqpIYYEVVPGRRPKGnnsdkyek---ggkgtlslLYAPWPGmkp 257 Chloroflexus...
ABP66126        186 ------------ffeiyfepspleyhthyredkkknkrVPYKLKYAKVERIsankegen---mergyliiTGDVGDKkhm 250 Caldicellulo...
Q6ZED5          470 lkpatdkkqlspadrvfgwvnqrgngcykgqlrihsvtCQHDDAIDDFGNQnfsvplai---lgqpkpeqARFYCADdrk 546 Synechocysti...
mbdal:THA_859   121 --------------------------------------------------------dnsyrkpyfwgtfeVTFEVEE--- 141 Thermosipho ...
Q0ATZ2          524 ---------------ttvqhylkqegsklldwndhtdiRGYKLYWHRKTPQegd--------------ygWEAIEDEink 574 Syntrophomon...
jgi:Teth39_0923 447 lirgyklywhrntpdgdskyswkaskieinyddfikflKKANISLDKSVILnsknivkdnkkiiinclyeKLTIEEKkel 526 Thermoanaero...
Q2FL77          350 -----------------------------------------------------------------kkgigNEYIPKRsal 364 Methanospiri...
WP_011986670    205 ------------------------------eemkrtkqEKNNLLGEDYVTPhgegkdkl---knpnpikfLKVMPNVvwc 251 Clostridium ...
4L6U_B          123 ------------------------------------------------------------------------EEVLKLAC 130 Archaeoglobu...
Q7MTH6          219 -----------------------------------------------------------------------eKLTVDFRT 227 Porphyromona...
WP_015942495    258 a--------------------------------------------------------------------anpQDVIPKLL 269 Chloroflexus...
ABP66126        251 qwiisepmnis------------------------------------------------ipidekvieeyrnDNDREEKY 282 Caldicellulo...
Q6ZED5          547 gipledgydrddgysdseqglrgrkvyphhkglpngywsnptedrsqqaiqghyqeyrrpkkdgleqrddqnRSVKGWVK 626 Synechocysti...
mbdal:THA_859   142 ------------------------------------------------------------------------KIINPIFY 149 Thermosipho ...
Q0ATZ2          575 aksqytkikpvy---------------------------------------------egatfsgriryenlsDIELGALL 609 Syntrophomon...
jgi:Teth39_0923 527 keyllwektkaqytii-------------------------------------kpikrnikfksrirfenltKEELGALL 569 Thermoanaero...
Q2FL77          365 mmym--------------------------------------------------------------vfdnmtQNEMEHIT 382 Methanospiri...
WP_011986670    252 fgfd--------------------------------------------------------------lkdfnkDIPADIKK 269 Clostridium ...
4L6U_B          131 YSLIGL------------------------VYFGGIGfrcsrgAGSLK 154 Archaeoglobus fulgidus DSM 4304
Q7MTH6          228 KLFKAI------------------------ICTFGLGaktnvgYGQFV 251 Porphyromonas gingivalis
WP_015942495    270 EAVEKL------------------------LTTYGISakrtvgWGTAK 293 Chloroflexus aggregans
ABP66126        283 NVLEKLeekkevpi---------fyltnenDRVVSIGh-----TGFFR 316 Caldicellulosiruptor saccharolyticus DSM 8903
Q6ZED5          627 PLTEFTfeidvtnlsevelgallwlltlpdLHFHRLGggkplgFGSVR 674 Synechocystis sp. PCC 6803
mbdal:THA_859   150 PLLYFM------------------------ELYGFWGgkwslgYGRLQ 173 Thermosipho africanus TCF52B
Q0ATZ2          610 FVLDLPt-----------------------GCAHKIGmgkplgLGSIK 634 Syntrophomonas wolfei subsp. wolfei str. Goe...
jgi:Teth39_0923 570 FVLDLPe-----------------------NHYHKIGmgkplgLGSIE 594 Thermoanaerobacter pseudethanolicus ATCC 33223
Q2FL77          383 QFFDKE---------------------------IQITgntsagISKYN 403 Methanospirillum hungatei JF-1
WP_011986670    270 KLFKQI------------------------LLDLGIGaktnvgYGRLE 293 Clostridium botulinum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap