4EAY


Conserved Protein Domain Family
UxuA

?
pfam03786: UxuA 
Click on image for an interactive view with Cn3D
D-mannonate dehydratase (UxuA)
UxuA (this family) and UxuB are required for hexuronate degradation.
Statistics
?
PSSM-Id: 397726
Aligned: 8 rows
Threshold Bit Score: 476.933
Threshold Setting Gi: 74557812
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4EAY_D  21 MEQTWRWYGP-NDPVSLADVRQA-GATGVVTALHHIPN-------GEVWSVEEILKRKAIIEDAGLVWSVVESVPIHEDI 91  Escherichia coli K-12
Q9WXS4   1 MKLVFRWYGEkHDTVTLEQIRQIpGVEGVVGALFDIPV-------GEVWPFEEIMKLKETVEKAGLKLEVIESVNVHEDI 73  Thermotoga maritima MSB8
Q9CF50   1 MEMTMRWFGSnADKIKLSEIAQVpGVKGVVGMIMDIPA-------GEIWPKERIKALKEEIEAAGLTLKVIESVNIHDDI 73  Lactococcus lactis su...
Q9KDZ8   1 MRMVFRWFGAgNDSVSLAHIRQIpGVEGIVWALHDIPP-------GEVWPLSRIMEIKEQAEQHQFHIDVVESVNVHEDI 73  Bacillus halodurans C...
O34346   1 MNMTFRWYGRgNDTVTLEYVKQIpGVKGIVWALHQKPV-------GDVWEKEEIRAETEYIQSYGFHAEVVESVNVHEAI 73  Bacillus subtilis sub...
Q9HK52   1 MKLRIAEILLeDRPNDFWRSLKLmGVDEVTGILPRWFAdwrnsyeDDPWDYYPLMRYRNMIEDSGFHLTAIEDNPPMQNI 80  Thermoplasma acidophilum
P44488   1 MEQAWRWYGP-KDPVSLSDIRQA-GATGIVTALHHIPN-------GEIWGIEEIKKRKTEIENAGLSWSVVESVPVHEEI 71  Haemophilus influenza...
Q9KEZ3   1 MRLTMRWFGP-SDKVKLEYIKQIpGMKGIVSAIYDVAV-------GGVWPKEKILALKNNIERHGLTLDVIESVPVHEDI 72  Bacillus halodurans C...
4EAY_D  92 KTHTGNYEQWIANYQQTLRNLAQCGIRTVCYNFMPVLDWTRTDLEYVLPDGSKALRFDQIEFAAFEMH--ILKRPGAEAD 169 Escherichia coli K-12
Q9WXS4  74 KLGLPTRDRYIENYKKTIRNLAKAGVKVVCYNFMPVFDWMRTDLHKKLPDGSETMEYDHRLIEGVTPDelIKRVKEGSQG 153 Thermotoga maritima MSB8
Q9CF50  74 KIGLPTRDKYIENYKETIRNLAEFGIEVICYNFMPVFDWLKSDLDYRLADNSQTMAFVARDIP-ANPQeiIDRVQAADGC 152 Lactococcus lactis su...
Q9KDZ8  74 KLGLPTRDRYIEAYKQTIKHLAKAGVKVICYNFMPVFDWVRTDLYKKLEDGSTALFYEKKEVDEMNPKg-LVETIASNKT 152 Bacillus halodurans C...
O34346  74 KLGNEERGRYIENYKQTIRNLAGFGVKVICYNFMPVFDWTRTDMFRPLEDGSTALFFEKAKVESLDPQe-LIRTVEEASD 152 Bacillus subtilis sub...
Q9HK52  81 IYGTERRDEEIENVIRMIRNFGRIGVKVWCYNWMAGTGWSRTNTHIPGGYGSYVTGFDRSFIGDDLP------------- 147 Thermoplasma acidophilum
P44488  72 KTQTGNYQKWINNYKQTLRNLAQCGIDTVCYNFMPVLDWTRTDLAYELPDGSKALRFDHIAFAAFELH--ILKRPDAEKT 149 Haemophilus influenza...
Q9KEZ3  73 KLGKPTRDRYIENYKQTLRHLAECGIDTVCYNFMPVFDWTRSQLDFKLEDGSEALIYEEDVIS---------RTNPLSGE 143 Bacillus halodurans C...
4EAY_D 170 YTeeeiaqaaerfatmsdedkarltrniiagLPGAEEGYtLDQFRKHLELYKDIDKAKLRENFAVFLKAIIPVAEEVGVR 249 Escherichia coli K-12
Q9WXS4 154 FV-----------------------------LPGWEWDR-LEKLRETFELYKNVDEEKLFENLVYFLERVIPVCEECDVK 203 Thermotoga maritima MSB8
Q9CF50 153 FS-----------------------------LPGWEPER-LSEVRGLFEAYKNVDEHKLRENFAYFLKAIIPTCEEVGIK 202 Lactococcus lactis su...
Q9KDZ8 153 FT-----------------------------MPGWEPER-LASLKTLFEAYEHVSTEDLWDHLHYFLQEVIPVAEACDIK 202 Bacillus halodurans C...
O34346 153 MT-----------------------------LPGWEPEK-LARIKELFAAYRTVDEEKLWDNLSFFLQEILPVAEAYGVQ 202 Bacillus subtilis sub...
Q9HK52 148 -------------------------------------------------RMGRIDAASLWKNLKYFLDEVIPVAEENDVR 178 Thermoplasma acidophilum
P44488 150 YNqeeqvaartyydnmseqdiaqltrniiagLPGAEEGYtLDEFQTQLDRYKDISSEKFRTHLAYFLNEIVPVAQEIGIK 229 Haemophilus influenza...
Q9KEZ3 144 LE-----------------------------LPGWDTSYeNESLKGVLQAYKKISEEDLWDHLTYFVQAIMPVADEVGIK 194 Bacillus halodurans C...
4EAY_D 250 MAVHPDDPPRP-ILGLPRIVSTIEDMQWMVDTVNSMANGFTMCTGSYGVRADNDLVDMIKQFGP--RIYFTHLRSTMREd 326 Escherichia coli K-12
Q9WXS4 204 LAIHPDDPPWS-IFGLPRIITNKENIERMLKAVDSPYNGITFCMGSLGANPENNIPEMIRYFGKmgRIHFAHVRNLKFT- 281 Thermotoga maritima MSB8
Q9CF50 203 MAVHPDDPPYP-MFGLPRVVKNREDLDWICNVVDSPSNAITLCTGSIAEDPANNVYEIMAEFVKrdRIPFAHVRNIKFLp 281 Lactococcus lactis su...
Q9KDZ8 203 MAIHPDDPPWP-IFGLPRIVTNHDNIRRLLKLVDHPTNGITLCSGALGADPNNQVPEMIREFAD--RIPFAHIRNIKRFd 279 Bacillus halodurans C...
O34346 203 MAIHPDDPPWP-IFGLPRIITGEASYKKLRAISDSPSNCITLCTGSMGANPANDMVEIAKTYAG--IAPFSHIRNVKIYe 279 Bacillus subtilis sub...
Q9HK52 179 LAMHPDDPPLPsFRGIDRIMNSIEAYQRLIDLNRSEYNGITLCQGNFTLMT-DDLPSVIRRFHDr--IYFVHFRDVSGN- 254 Thermoplasma acidophilum
P44488 230 MAIHPDDPPRP-ILGLPRIVSTIEDMQWFVETQPLPANGFTMCTGSYGVRSDNDLVKMTEQFAD--RIYFAHLRSTQREg 306 Haemophilus influenza...
Q9KEZ3 195 MAIHPDDPPWS-IFGLPRIVTNKANLERLLSLYDSPNHGITMCSGSLGANEANDLPEMIRHFGGqgRIHFAHARNIKRT- 272 Bacillus halodurans C...
4EAY_D 327 -NPKTFHEAAHLN--GDVDMYEVVKAIVEEEHRRkaegkedliPMRPDHGHQMLDDLkkkTNPGYSAIGRLKGLAEVRGV 403 Escherichia coli K-12
Q9WXS4 282 -GEKSFYETAHPSfcGSHDLFEVMKAFHDIGYEG---------YIRPDHGRLIWGEK---ARPGYGLYDRALGATYILGL 348 Thermotoga maritima MSB8
Q9CF50 282 sGKKDFYEAPHMSkyGSLDMYKIMKAMYDNGFDG---------YIRPDHGRMIWGET---GRPGYGLYDRALGASYLNGL 349 Lactococcus lactis su...
Q9KDZ8 280 --NGDFVETSHREqdGSIDIVSIVKAYHEVGFTG---------YVRPDHGRHIWDEQ---CRPGYGLYDRALGIMYLWGI 345 Bacillus halodurans C...
O34346 280 --NGDFIETSHLTkdGSINIQGVMEELHKQDYEG---------YVRPDHGRHLWGEQ---CRPGYGLYDRALGIMYLNGL 345 Bacillus subtilis sub...
Q9HK52 255 --SEKFVETLIGR--GKTDMAACMNAYIEVDYRW---------IMRIDHSPTFPGDHe--LIPGYSYTGRIYSIGYVQGL 319 Thermoplasma acidophilum
P44488 307 -NPLTFHEAAHLE--GDVDMFNVVKALLNEEYRRlnqgetrliPMRPDHGHQILDDLrkkTNPGYSAIGRLKGLAEFRGL 383 Haemophilus influenza...
Q9KEZ3 273 -GPRSFQESAHLSeaGSVNMVAMLKAYHDIGFTG---------PLRPDHGRMIWGEK---GRPGYGLYDRALGATYLNGI 339 Bacillus halodurans C...
4EAY_D 404 ELAIQR 409 Escherichia coli K-12
Q9WXS4 349 WEAIDK 354 Thermotoga maritima MSB8
Q9CF50 350 WEALEK 355 Lactococcus lactis subsp. lactis Il1403
Q9KDZ8 346 WDSVQN 351 Bacillus halodurans C-125
O34346 346 WDAYEA 351 Bacillus subtilis subsp. subtilis str. 168
Q9HK52 320 FDSLSN 325 Thermoplasma acidophilum
P44488 384 EMALKK 389 Haemophilus influenzae Rd KW20
Q9KEZ3 340 WEAVSS 345 Bacillus halodurans C-125
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap