Conserved Protein Domain Family
Asp23

?
pfam03780: Asp23 
Asp23 family, cell envelope-related function
The alkaline shock protein Asp23 was identified as an alkaline shock protein that was expressed in a sigmaB-dependent manner in Staphylococcus aureus. Following an alkaline shock Asp23 accumulates in the soluble protein fraction of the S. aureus cell. Asp23 is one of the most abundant proteins in the cytosolic protein fraction of stationary S. aureus cells, with a copy-number of >25000 per cell. A second Asp23-family protein, AmaP, which is encoded within the asp23-operon, is required to localize Asp23 to the cell membrane. The overall function for the family is thus a cell envelope-related one in Gram-positive bacteria.
Statistics
?
PSSM-Id: 397721
Aligned: 129 rows
Threshold Bit Score: 69.8355
Threshold Setting Gi: 81364139
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAM01180       41 SQGRTSIAASVVQKIAGIAAKEISGVHAMGGGvsrAFGALRERIPGgsaASSTSGVQV-EVG--EkQAAVDLDIVVEYGA 117 Saccharopolysp...
EDM62219       16 dLGIITIDPEVIAKYAGTVAVECFGIVGMAAVn--MKDGLVHLLKK---ESLTRGIHV-NISd-DnHISIDFHIIVAYGV 88  Dorea longicat...
WP_004845068    8 dLGIITVNPEVIAKYAGSVAVECFGIVGMAAVn--MKDGLVRLLKK---DSLTHGIQV-TISd-NnEITLNFHVIVAYGV 80  [Ruminococcus]...
WP_005424603    8 gLGQIVIDTDVIATYAGSVAVECFGIVGMAAVs--MKDGLVKLLRK---DSLKHGISV-TITe-DnRIRLNFHVIVAYGV 80  Blautia obeum
jgi:Haur_0366  14 DAGRIEVHSRAIATVVAGAVVRCYGVVGMAPRn--LRDSVAHVLRP---EDQYKGIDV-Q-Vs-TeAITVDLFVIIEYGT 85  Herpetosiphon ...
Q9X292          6 ENGELEITLNALKKIVYFATLESYGTVGLGDS-----RSFFERI-----FGGDRGIKI-EELe-DsSLNVDVYIEVEYGV 73  Thermotoga mar...
WP_011994664    6 EYGEVEITVNALRKLTYLAVMETYGPISIGSD-----NWFSKWF-----SSEEGKIKV-EEDe-YgHINIDIFVEVEYGT 73  Fervidobacterium
Q5SLS8          1 MPGRVVLTEAALASLLALVAHEVPGVVGMAPAg--LKDQVGRILGR---QEAGEGVVVrPDPqsPgRYQVDLYVVLAYGT 75  Thermus thermo...
Q9RXC6          1 MSGSIQITEAALASLIGLTAHEIPGVVGMAPAn--LKEGLSRVLGR---ANVSDGVVI---GkdGgKFTADLYIVAAYGV 72  Deinococcus ra...
WP_011530847    1 MTGSIVISEAALASLIGLTAHEIPGVVGMAPAn--LKEGLSRVLGR---ANAREGVVV---TreGgAYAADLYVVVAYGV 72  Deinococcus ge...
CAM01180      118 SIVDLARAVRRNVIGAVERMTGLEVIEVNISVNDIH 153 Saccharopolyspora erythraea NRRL 2338
EDM62219       89 SISAVTDNLISDVKYRVEEFSGMQVDKINVYIEGVR 124 Dorea longicatena DSM 13814
WP_004845068   81 NILSVSDNLMSNVKYKVEEFTGMAVEKINIFVEGVR 116 [Ruminococcus] torques
WP_005424603   81 NISTIADNLVSNVKYKVEDFTGMEIEKINIYVEGVR 116 Blautia obeum
jgi:Haur_0366  86 RIATVARNIMESVQYAVVHALGEANITVNVHVQGLR 121 Herpetosiphon aurantiacus DSM 785
Q9X292         74 NIREVAKNIADNVAHKLKTLAGCEKLNITVHVVGIR 109 Thermotoga maritima
WP_011994664   74 KVTEVGRNIEENVRHKLQYLANCENVDVNVHIIGVK 109 Fervidobacterium
Q5SLS8         76 RVPALAEALGERLAYAARHLGGVELSQVRVHVVGVR 111 Thermus thermophilus HB8
Q9RXC6         73 NIPRVAENITERVQHIVKTQAGIDLAALRVHAVGVQ 108 Deinococcus radiodurans
WP_011530847   73 SIPTVARNIKDRVEHIVKTQAGIELGATRVHAVGVQ 108 Deinococcus geothermalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap