Conserved Protein Domain Family
SPW

?
pfam03779: SPW 
SPW repeat
A short repeat found in a small family of membrane-bound proteins. This repeat contains a conserved SPW motif in the first of two transmembrane helices.
Statistics
?
PSSM-Id: 397720
Aligned: 51 rows
Threshold Bit Score: 31.4143
Threshold Setting Gi: 491659734
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Tbis_1639  57 SWVIPLLGLWTIFSPWLVrGGDVRTgGMITNNIITGIVILVLGLAAMMVA 106 Thermobispora bispora DSM 43833
WP_014044974   38 daPVFLAGLYAAVSPWVL-HFTANQpSLVVHNVVIGLAIAVLALCFTAMP 86  unclassified Streptomyces
DU:RAM_29195   36 DGLVLISGLYIAMSPWVV-GFSHYG-DMAVVTLISGLALVLLGAGFSAAY 83  Amycolatopsis mediterranei S699
Q0S5M3         34 EGLMFMAGLYMAASPWIV-GFASQS-GLAMCNLLSGVAVALLAVGFTSAY 81  Rhodococcus jostii RHA1
O07432         34 FGLALLAGLYVAASPWIV-GFSATR-GLPTCDLIVGIAVAYLAYGFASAL 81  Mycobacterium tuberculosis
CAM04657       33 DGAIVLGGLFIALSPWIA-GFSGVG-SLAMNNFVTGLATAVLGLCFAAAF 80  Saccharopolyspora erythraea NRRL 2338
jgi:Tbis_1670  33 DGLNMVAGLYLALSPWIV-GFQNLT-GITVNNLITGLLVSMLALSYSSAf 80  Thermobispora bispora DSM 43833
WP_107985569   35 EGLMVLAGLYAAASSWIV-GFSGQT-SLMMSNLICGLAVALLAAGYATTY 82  Rhodococcus sp. OK519
SUE15442       36 DGLMMVAGLYAAASAWII-GFADQT-ALATTNLICGLAVALLAMALGSAy 83  Rhodococcus gordoniae
EST32632       18 DGPIFLAGLFIALSPWIL-HYTTSQpGLVVHNVIMGIAIAGLALVFSATP 66  Streptomyces niveus NCIMB 11891
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap