Conserved Protein Domain Family
Remorin_C

?
pfam03763: Remorin_C 
Remorin, C-terminal region
Remorins are plant-specific plasma membrane-associated proteins. In tobacco remorin co-purifies with lipid rafts. Most remorins have a variable, proline-rich N-half and a more conserved C-half that is predicted to form coiled coils. Consistent with this, circular dichroism studies have demonstrated that much of the protein is alpha-helical. Remorins exist in plasma membrane preparations as oligomeric structures and form filaments in vitro. The proteins can bind polyanions including the extracellular matrix component oligogalacturonic acid (OGA). In vitro, remorin in plasma membrane preparations is phosphorylated (principally on threonine residues) in the presence of OGA and thus co-purifies with a protein kinases(s). The biological functions of remorins are unknown but roles as components of the membrane/cytoskeleton are possible.
Statistics
?
PSSM-Id: 397709
Aligned: 96 rows
Threshold Bit Score: 74.9146
Threshold Setting Gi: 30697834
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_013742531 263 EAEPNSASWDISEPAMTLFKLHREEAKIAAWENLQKAKAEAAMRKLEVKLEKKKSASMDKILNKLQTAKLKAQDMRRSTT 342 rape
ERN00893     137 ELETKINAWQTAKISKVNNRFKREEAIISGWESEEIHKANSKMKKVERKLEERRAKAYERMQNDIARAHRKSEEKRASAE 216 Amborella trich...
KRH71974     190 EVEAKISAWQNAKVAKINNRFKREDAVINGWENEQVQKASSWMKKVERKLEEKRARALEKMQNDVAKAHRKAEERRASAE 269 soybean
P93758       162 EVEAKITAWQTAKLAKINNRFKREDAVINGWFNEQVNKANSWMKKIERKLEERKAKAMEKTQNNVAKAQRKAEERRATAE 241 thale cress
XP_009397217 163 EVESKISAWQTAEVSKINNRFKRQEVTINGWENEKVEKATAWLKKVERKLEEQRARAMEKMQNDVAKAHHKAAEKRASAE 242 wild Malaysian ...
XP_020187781 162 EAEAKVAAWQAEEVAKINNKFKREEVVINGWENQQIHTATTYLSKIERKLEEERAKATEKAQNEVARARRKAEEKRASAE 241 Aegilops tausch...
EEF47806     144 AVEDKIDSWEKAQLRKINKRYEKMKAEVLAWENAKKIEAKMHMERKKNELELRKSRNLQYYQIKVERIEAVAGGAKGQLE 223 castor bean
CBI15154     118 SVETKADAWEKAQITKIKKRNDNISSRILAWENEKKMRAKLIMERKKSELEQRKALNLQHYQIKIERIDQIAGGARAQLQ 197 wine grape
Q9FLK5       151 SASSKADSWEKSQIKKIRLRYEKMKADIVGWENERKLAATLLMEKRKSELEKRKGINNQHYKSKLARIQLIADGAKKQLE 230 thale cress
KRH54632     148 hKNDKATLWEKAKIERIQKRYEKTKSKILAWESYRKIQAKMQMDRKKSEWEHKRAIEMQHYKNKIARIDMIAQGAISQLE 227 soybean
XP_013742531 343 ASSgdhgkEEQISRNSAKiTTHLVRRHTFMSP 374 rape
ERN00893     217 AKR-----GTRTTKILEL-ANLMRAVGKFPPK 242 Amborella trichopoda
KRH71974     270 AKR-----GTKVARVLEI-ANLMRAVGRAPTK 295 soybean
P93758       242 AKR-----GTEVAKVVEV-ANLMRALGRPPAK 267 thale cress
XP_009397217 243 AKR-----GTKVAKVLEL-ANFMRAVGRAPSK 268 wild Malaysian banana
XP_020187781 242 AAR-----GTKTARVMDL-ANFMKAVGRLPTK 267 Aegilops tauschii subsp. tauschii
EEF47806     224 EKR-----RSEESEVKEK-ARNMRLKGKNPVR 249 castor bean
CBI15154     198 EKR-----RNEESEVKHK-AEMIRKTGKVPVR 223 wine grape
Q9FLK5       231 EKR-----RSKEAQVHGK-VKKMSRTGKVPNN 256 thale cress
KRH54632     228 DHK-----RKQESKAKEK-AKKIRKTGRVPVK 253 soybean
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap