Conserved Protein Domain Family
LEA_1

?
pfam03760: LEA_1 
Late embryogenesis abundant (LEA) group 1
Family members are conserved along the entire coding region, especially within the hydrophobic internal 20 amino acid motif, which may be repeated.
Statistics
?
PSSM-Id: 397707
Aligned: 37 rows
Threshold Bit Score: 32.6724
Threshold Setting Gi: 223534202
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_004249727   1 MEAAKQTAANVAASAKSGMEKTKAVVTEKTEKLTTSDPVQRQMATEKKEQRIHQAEMDKLAAKEQNAASRQ 71  tomato
XP_004976638   1 MQPAKVKAKDMVSSAKEKVKEGSAKMQGKTGEATAATHGEKEMAKEAARAKKDQATADMHQEKAEHRADAt 71  foxtail millet
ERN09303       1 MASAKEKVSNMVSSAKEHADIYKAKAEEKAEKARARNKEEKEIADEREKAKVAEAKMQHHGAKAEHKAEKE 71  Amborella trichopoda
XP_006361178   1 MHSVKEKVSNAAAAGKEHVDILKAKAEEKAEKAVARTREEKRIAEEVRKAKEAEAKMELHQAKARHAAETL 71  potato
Q9ZTZ2         1 MQSSKEKMKNMASAAKEQVDIYKAKIDEKAEKATARTEEERVIAHEHAKAKEAGAKMELHEAKARHAAEKL 71  soybean
EEF42438       1 MKSAKEKISNMASAAKEHITICRAKVDEKVEKAAARTPEQKQIAKERRKAREAQAKMELHQAKAKHAAQKS 71  castor bean
RVW49958       2 MQSYKEKISNMASVAKEHITICKARAQEKAEKAMARTKEEKEIAKERRKAKEAQAKMQLHAEKAEHAARKL 72  wine grape
XP_009107977   1 MQSAKQKLSDLASTAKKKMVICRAKVEEKAEKARARTKEEKKIAHERRKARQAEAKLDMHVAKEAHAEEKL 71  field mustard
Q39138         1 MQSAKQKISDMASTAKEKMVICQAKADEKAERAMARTKEEKEIAHQRRKAKEAEANMDMHMAKAAHAEDKL 71  thale cress
EAZ31805       1 MQTAKVKVQDMVSGAKEKVKEGTAKAHGKAGQATAATHGEKEMAKQEEKAGKAQAKADEHQERAEHRANAt 71  Japanese rice
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap