2NTX


Conserved Protein Domain Family
PRONE

?
pfam03759: PRONE 
Click on image for an interactive view with Cn3D
PRONE (Plant-specific Rop nucleotide exchanger)
This is a functional guanine exchange factor (GEF) of plant Rho GTPase.
Statistics
?
PSSM-Id: 397706
Aligned: 54 rows
Threshold Bit Score: 502.085
Threshold Setting Gi: 685305827
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2NTX_B         9 ADXEXXKDRFAKLLLGEDXSGGGKGVSSALALSNAITNLAASIFGEQTKLQPXPQDRQARWKKEIDWLLSVTDHIVEFVP 88  thale cress
XP_009404557 100 DIELMKERFSKLLLGEDMSGCGKGVCTALAISNAITNLCATVFGQLWRLEPLPPEKKSMWRREMEWLLCVSDHIVDLMPS 179 wild Malaysian ...
Q56WM6       135 LDVEAMKEKFSKLLLGEDVTGGCKGVQVALALSNAVTHLATSIFGELWKLEPLCEEKKQKWRREMDWLLSPTNYMIELVP 214 thale cress
XP_004253076 102 SDVEMMKERFAKLLLGEDVTGGSKGVSTALALSNAITYLAASVFGELWKLEPLAEERKIKWRTEMDLLLSPTNHMIELVP 181 tomato
XP_004246025 115 SDLETMKEKFAKLLLGEDVTGGSKGVSTALALSNAITNLAASVFGELWKLEPLAEDGRRKWKREMEWLLSPTNHMIELVP 194 tomato
CBI29214     118 SDVEVMKERFSKLLLGEDITGGKKGLTSALALSNAITNLAVSVFGELWKLEPLSEERKVKWQREMDWLLSPTNYMVELVP 197 wine grape
XP_006573494 115 SDIEAMKDKFSKLLLGEDVTGGTKGLSTALALSNAITNLAVTVFGELWKLEPLSEERKRKWQREMDWLLSPTNYMVELVP 194 soybean
XP_006599119 119 SDVEAMKEKFAKLLLGGDVTGGAKGLNTALALSTAITNLAVTVFGELWKLEPLSEERKSKWRREMGWLLSPTNYMVQLVP 198 soybean
EEF42526      91 SDVETMKEKFAKLLLGEDITGGCKGLTTALALSNAIANLAASVFGELWKLEPLPEENKKKWRKELDWLLSPTNYMVELVP 170 castor bean
ERM94791     142 IDVETMKERFAKLLLGEDMSGGCRGLNTASALSNGITNLAGSTFGELWKLEPLSEERKTKWVKEMDWLLSPASYMVELVP 221 Amborella trich...
2NTX_B        89 SQQTSKDGVCTEIXVTRQRGDLLXNIPALRKLDAXLIDTLDNFRGhNEFWYVSRDSE------EGQ-QARNDRTNDKWWL 161 thale cress
XP_009404557 180 WQTFPDGSKLEVMTCRPRSDLYINLPALRKLDNMLLEILDSFNDP-EFWYVDQGIVApdsdgsASFrRTLFRQEEKWWLP 258 wild Malaysian ...
Q56WM6       215 SKQNDANGRSLEIMTPKARADIHMNLPALQKLDSMLIETLDSMVN-TEFWYSEIGSRa-----EG--KNKSTSESKRWWL 286 thale cress
XP_004253076 182 ARQSGSNGQGLEIMTPKVRADIHMNLPALRKLDSMLLETLDSMVS-TEFWYTEVSSRa-----EG--------KNTKWCL 247 tomato
XP_004246025 195 AKQTGSNGQKLEIMVPKARADIHMNLPALQKLDSMLLEALDSMVN-TEFWYTEVGSRa-----EG--RSRSAGESKRWWL 266 tomato
CBI29214     198 AKQSGANGRTLEIMTPKARADIHMNLPALQKLDSMLIETLDSMVD-TEFWYAEGGSRa-----EG--RTRSMSQSKRWWL 269 wine grape
XP_006573494 195 AKQSSSNGGIFEIMTPKARADIHMNLPALQKLDSMLIETLDLMMN-TEFWYAEGGSQa-----EGR-RDTNSQHSKRWWL 267 soybean
XP_006599119 199 AKQNGANGGIFEIMTPKARADIQMNLPALQKLDSMLIEALDSMVQ-TEFWYAEEGSRs-----AG--RNTSGRQSRRWWL 270 soybean
EEF42526     171 TKQNGANGRTLEIMTPKARADIHVNLPALQKLDSMLIETLDSMVN-NEFWYSEVGSRa-----EG--RSKSTKQSKRWWL 242 castor bean
ERM94791     222 AKQSDANGRSLEIMTPRARSDIHMTLPALRKLDSLLIETLDAMVD-TEFWYAEGGSRr-----EN--RSRSAKTSMKWWL 293 Amborella trich...
2NTX_B       162 PPVKVPPGGLSEPSRRXLYFQKDSVTQVQKAAXAINAQVLSEXEIPESYIDSLPKNGRASLGDSIYKSITEEWFDPEQFL 241 thale cress
XP_009404557 259 VPHVPLDGLHENTRKQLQHKRECANQILKASIAINTDTLAEMEVPETYLSSLPKNARASLGDLMHRYVTSDQFSPDCLLD 338 wild Malaysian ...
Q56WM6       287 PSPQVPKPGLSNSGRKKLLDKGKVVYQVFKATKAINENILLEMPVPIVIKEAIPKSGKNSLGDELYKMLAVESATVDEIF 366 thale cress
XP_004253076 248 PSPKVPVAGLSEVERKKLVNQGKLTNQILKAAKAINENVLAEMPVPTVIKDALRKSSRTSLGDDLYRILTAESTSAEEML 327 tomato
XP_004246025 267 PSPQVPIAGLSDPERNKLLNQGKLVNQIYKAAKAINENVLSEMPVPTIIKDALPKSGRTSLGEDLYRILNAESTSMEDML 346 tomato
CBI29214     270 PSPQVPTTGLSDPERKKLLHQAKVVHQVFKAARAINENVLLEMPVPTLIRDALAKSGKANLGEELYRVLTAESSSAEEML 349 wine grape
XP_006573494 268 PSPQVPKTGLSDTERKRLLHQGRVVRQVFKAAKAINESVLLEMPVPSIIKDALAKSGKANLGQELHKVLMAESSSGEDML 347 soybean
XP_006599119 271 PSPRVPRMGLSDIERKRLLNQGRVVQQIFKAAKAINDSMLLEMPMPTIIKDALLKSGKASLGEELHKVLMAESSSGEEML 350 soybean
EEF42526     243 PLPQVPTTGLSDSERKKLLHKSKVVYQVFKAAKSINENILLEMPVPTIIRDALPKSGKTNLGEELYKILTTESKTAEDML 322 castor bean
ERM94791     294 PLPRVPLSGLSPEARKKLGFRRNCISQVFKAAKAINEQVLLEMPVPPAFLDTLPKAGRTSLGEVLYRAICTEPCRPEEVV 373 Amborella trich...
2NTX_B       242 AXLDXSTEHKVLDLKNRIEASVVIWKRKLHTKd---------TKSSWG----SAVS--LEKRELFEERAETILVLLKQKF 306 thale cress
XP_009404557 339 CLDLSSEHQALEIANRVEASTYIWRRRRVARPvsnrngiattKSSWRTavkdMVVDaaGKRELFADRAETILLCLKQRFP 418 wild Malaysian ...
Q56WM6       367 ISLNLGTEHAALETVNKLESAMFAWKERITEQgsng---kspVRASWSfa-kDPLSe-IGRNESLLNRAEALRTQIKSKH 441 thale cress
XP_004253076 328 ISLNLKSENSAVEVVNRLEGSILAWKERITDQasg----kspARRSWSfv-rDPISe-LDKVEFLLNKAESLVQQLKFEY 401 tomato
XP_004246025 347 NFLNVRSEHNALEAVNRLEAAILAWKEKVADHvcg----kspARTSWSfk-kDPISe-LDKIEVLSSRAEALLQQLKNKY 420 tomato
CBI29214     350 SSLNLKSEHSALEAINRLEAAVFAWKERITEQvsg----kspVRTSWSfi-kDPTTe-LDKMELILFRAEALLQQLRTRY 423 wine grape
XP_006573494 348 KYLNLKSEHLVLETVNRLEAAIFSWKERIAEQvsg----kspVRSSWSpfvkDPMSe-VDKLELLLDRAETLLQLIKIRY 422 soybean
XP_006599119 351 KALNLSSEHTALETINRLEAATFSWKERIIQEnsg----kspVRTSWSfm-kDPMAg-IDKMELLLERAETLLSMLKARY 424 soybean
EEF42526     323 NSLDLKSEHSAIEVINKLEAALFAWKQKITAQisg----kspVRTSWSfv-kDPMSe-FDKTESLLDRAEALLQQVKARY 396 castor bean
ERM94791     374 NLREMETEDGALEAANRLQTAILMWKQRITSAsseg---kvgVLNSWSlv-rDSEAe-LDKKEVYLERAKAVMYHLKRKF 448 Amborella trich...
2NTX_B       307 PGLPQSSLDISKIQFNKDVGQAVLESYSRILESLAYTVXSRIEDVLYTDTLALK 360 thale cress
XP_009404557 419 GLTQTALDVCKIQFNKDLGKSILESYSRVLESLAFNIVARIDELLYVDDFSKNS 472 wild Malaysian banana
Q56WM6       442 PNLPHSFLDATKIQYDKDIGHAVLEAYSRTLANLAFRILSRMGEILKEDSLSNP 495 thale cress
XP_004253076 402 PNLPQTFLNVTKIQYGTDIGHSILEAYSRVLLNLAHNILTRIGEVLQVDFSSNv 455 tomato
XP_004246025 421 PNLPQTFLNVTKIQYGKDIGCSILEAYSRVLLNLAFSILTRIGEILQEDILSNp 474 tomato
CBI29214     424 PNLPQSFLDVAKIQYGKDIGHSILEAYSRVLGNLASSILCRMRDILQEDVFSNp 477 wine grape
XP_006573494 423 PNLPQTFLDATKVQYGKDIGHSILEAYSRVLGNLAFSIVSRIGDVLQEDSLSNP 476 soybean
XP_006599119 425 PNLPQTFLDAAKVQFGKDIGHSILEAYSRVLGSLAFSILSRIADILQEDSLSNP 478 soybean
EEF42526     397 PNLPQTFLEATKIQYGKDVGHSILEAYSRVLGNLAFSILCRIGDILQEDASTNP 450 castor bean
ERM94791     449 QRMPQTFLDMTKVQHNKDIGHSILEAYSRVLEGLAFSILSRIEDILQEDDMVKS 502 Amborella trichopoda
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap