1IXP,3O6D


Conserved Protein Domain Family
PdxJ

?
pfam03740: PdxJ 
Click on image for an interactive view with Cn3D
Pyridoxal phosphate biosynthesis protein PdxJ
Members of this family belong to the PdxJ family that catalyzes the condensation of 1-deoxy-d-xylulose-5-phosphate (DXP) and 1-amino-3-oxo-4-(phosphohydroxy)propan-2-one to form pyridoxine 5'-phosphate (PNP). This reaction is involved in de novo synthesis of pyridoxine (vitamin B6) and pyridoxal phosphate.
Statistics
?
PSSM-Id: 397693
Aligned: 365 rows
Threshold Bit Score: 241.506
Threshold Setting Gi: 123492106
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1IXP_B           5 LGVNIDHIATLRNARGTA-YPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQ---TLDT-------------R 67  Escherichia coli
CDE09685         4 LSVNVNKVATLRNARGEG-IPDVQKFATDCEALGAQGITVHPRPDERHITRRDVALLKP---IITT-------------E 66  Prevotella sp...
WP_015693170     6 LSVNLNKVALIRNARGAN-FPNLLQVALDCEKFGAEGITVHPRPDQRHIRYDDIPELRG---KIAT-------------E 68  Saprospira gr...
jgi:Halhy_4556   6 LSVNINKIALIRNSRGAN-LPDLTQIARDCEAFGAQGITVHPRPDERHVRFDDLPLLQA---TVRT-------------E 68  Haliscomenoba...
B0SJ25           4 LSVNVNKIATLRNSRGGS-LPSVLKLSELILDSGAHGITVHPRSDERHITKQDVFELQE---FLRTynekitklgiskkE 79  Leptospira bi...
Q8F5Z9           5 LSVNINKIATLRNSRGGN-IPDLSYFANLVLKAGAHGITVHPREDERHIRKEDVFVLKE---FIDSynrkn----ntniE 76  Leptospira in...
CAN96002         3 LSVNVNKIALLRNSRGHD-APNVLSFARKIVDYGAHGITIHPRADRRHITPDDARAVTRhitTV---------------E 66  Sorangium cel...
WP_012828361     5 LSVNLNKVALLRNSRGAD-NPCPVRAAEACIAAGAPGLTLHWREDERHTREGDVRALRK---LADErg----------vE 70  Haliangium oc...
WP_014745110    28 LGLRLNHAALLRQAGDGQ-RPDMARLAEATVKAGADSVVLRVDDGSGLITADDVRRIAE---RARV-------------P 90  Tistrella mob...
WP_006930944     4 LAVDIDPIAFVRNSF-NDkYPDPIQAVVLAELGGAESIVAYLHDNQKTVKETDIVLLKH---IVKT-------------Y 66  Caldithrix ab...
1IXP_B          68 MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDV--AGQRDKMRDACKRLADAGIQVSLFIDADEEQIKAAAE 145 Escherichia coli
CDE09685        67 FNIEGYPSEEYLQLVLANKPTQATLVPDAADVLTTNEGWDV--ECHAEFLRGVVKRLKDDGIRVSIFVAADPRQIRAAAA 144 Prevotella sp...
WP_015693170    69 FNIEGNPTPEFMDLLRKYPSDQVTLVPDAAQALTSDSGWDT--LAFASFLQEVTEELKSLGARVSIFVDPDPKMIEGAKK 146 Saprospira gr...
jgi:Halhy_4556  69 FNIEGNPDPRFLREVMQVKPHQATLVPDGPQALTSDQGWDT--AKHHDFLVDVVAQLQSVGTRVSIFVDAEERFVEGAKR 146 Haliscomenoba...
B0SJ25          80 YNIEGEPSERFLDLVLKAKPDQATLVPVKPGEITSDHGFQFadQKTFSTLKPIVEAIRKEGIRVSLFMETDFTFYDQVVA 159 Leptospira bi...
Q8F5Z9          77 YNLEGEPSPRFLDLVLKTKPDQATLVPVTPGEITSDHGFDF--EKDMEILSEYSKILKKDKIRVSLFVETGLKNLKLASL 154 Leptospira in...
CAN96002        67 TNFEGDLREEFLDLTLELRPTQCTLVPVTPGELTSHRGWDV--AKWRFVLQPVVKRLKEEGIRTSLFVEADPAVVPLVAE 144 Sorangium cel...
WP_012828361    71 FNLEGDARPAIVAIALELRVTQFTLVPVTPGEITSDHGWDL--PREHDTLAPILERCRAAGVRTSIFMDPVAENMAAAAR 148 Haliangium oc...
WP_014745110    91 LTLEMRPDPARVAWVTSLSPAAVMLLPES--------------EADVARMAEVASGLHEAGVPVLALVAPEMEAIDQVHA 156 Tistrella mob...
WP_006930944    67 LNIRCNLTEENVRKLLRIKPDMVTFVAPGELHDIAPHPLNV--DMYPTQLQDFIIELRTNGILSSVLIEPQVEQVKLAGK 144 Caldithrix ab...
1IXP_B         146 VGAPFIEIHTGCYADAKTD-AEQ-AQEL-ARIAKAATFAASLGLKVNAGHGLTYHNVKA-IAAIPEMHELNIGHAIIGRA 221 Escherichia coli
CDE09685       145 VGADRVELYTKPYADAYd--TDR-DAAV-APFIVASQTAADCGLGVNAGHDLNSHNLRFfAESMPKLDEVSIGHAIISEA 220 Prevotella sp...
WP_015693170   147 LGADRVELYTGPYAHEYk--ADR-AAAI-APYIKAAEAAAAVGIELNAGHDLNLVNLAYfKQNIPNLLEVSIGHALTVDA 222 Saprospira gr...
jgi:Halhy_4556 147 VGADRIEFYTGHYAKVFp--SNP-IEAV-KKHVHCAKLAVELGLGINAGHDLNLKNLSFyKDQVQGLMEVSIGHALVCDA 222 Haliscomenoba...
B0SJ25         160 LGAERIELYTGPFAHAFDLsEEKgKEIF-TDYQRAAIEANKLGLAVNAGHDLDTNNLRv-FAKLPYLKEVSIGHRLMAQS 237 Leptospira bi...
Q8F5Z9         155 SGADRVEFYTGPFAEAFDHsPQIgKKRFeTEYVPAATEILNQKMGINAGHDLDHENLKI-FSKLPGLQEVSIGHRLISRA 233 Leptospira in...
CAN96002       145 MGADRIEIYTGPYAQAFd--RGEhRAEL-DKIVATVRAAVAAGVGINAGHDLTVENLAPlVREAPQIQEVSIGHHLVAHA 221 Sorangium cel...
WP_012828361   149 TGVDRVEIYTEPYAAAFg--TATqDQAL-AQTAAAVAAARARGLGVNAGHDLDLYNLPLlARAAPGIDEVSIGHALIADA 225 Haliangium oc...
WP_014745110   157 SGIRGIELDTTFYGEAA---EEVrAPLL-QQIRHAASHAHGIGLGLQAGHALDYSTLAP-IAGLPHIQGITCGRFLITEA 231 Tistrella mob...
WP_006930944   145 LEFDYVELDATGLANAEDMdSE--IALL-QELDNLSLAANKLGMGVNISGGIGYDNIRD-ITKMENIEDIIVGKPLFSKS 220 Caldithrix ab...
1IXP_B         222 VMTGLKDAVAEMKRLM 237 Escherichia coli
CDE09685       221 LYDGIATVIKRYRDCl 236 Prevotella sp. CAG:485
WP_015693170   223 LYMGFQNVIPLYKNCl 238 Saprospira grandis
jgi:Halhy_4556 223 LYYGLQNTIQMYLRql 238 Haliscomenobacter hydrossis DSM 1100
B0SJ25         238 LVDGLETTVKSYLKVL 253 Leptospira biflexa serovar Patoc strain 'Patoc 1 (Paris)'
Q8F5Z9         234 LETGIDQSVKDYLQAL 249 Leptospira interrogans
CAN96002       222 LEVGMKQSVRDYLAAV 237 Sorangium cellulosum So ce56
WP_012828361   226 LYWGLERTVRAYLDAa 241 Haliangium ochraceum
WP_014745110   232 LFIGIEEAVRHTRRLI 247 Tistrella mobilis
WP_006930944   221 LAIGFEQAVRDLIALM 236 Caldithrix abyssi
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap