Conserved Protein Domain Family
YjgP_YjgQ

?
pfam03739: YjgP_YjgQ 
Predicted permease YjgP/YjgQ family
Members of this family are predicted integral membrane proteins of unknown function. They are about 350 amino acids long and contain about 6 transmembrane regions. They are predicted to be permeases although there is no verification of this.
Statistics
?
PSSM-Id: 397692
Aligned: 85 rows
Threshold Bit Score: 117.002
Threshold Setting Gi: 81364557
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_015480151    7 YILKSFLVPFIATFLIVLFVLVMQALWQAFENIAGKGISVIFILKFLYYTTLMIIPQALPIGVLLSSIMALGNLGENYEF 86  Polaribacter s...
O84846          7 vLIFRYLKTTVFCTLSLICISIISSLQEIVSYI-AKDVPYATVFKVTAYQIPYLLPFILPASCFISAFTLFRKLSDNNQI 85  Chlamydia trac...
Q31ET4          7 YLYKELFATFFAVLSVLLLITFGTEATKLLAVAVEGAIPSTVIMQVLLYKIPPALEVILPLVALLSVMLAVGRLYQDQEM 86  Hydrogenovibri...
jgi:Rmag_0478  21 YLMRNVSVLLSVVFIVISLVVFGNQLVLIIKETSKEGIPIADLLPLVGLNMIRDVVLILSLSLLLAIILSVSKLYKASEA 100 Candidatus Rut...
Q8D296          6 YLIKKILKSQFHILCILFLIFFCQKLVRILSSMSEELIPKKIIFFLLILYIPEIIKLILPLSLFISIALVMQKLHNSNEI 85  Wigglesworthia...
Q7VQS9          6 YIMKEICKNQLIILILLLLACFCQKSIKVLS--LSNNIPIYWIFLYLFLSIPDLGKLIIPFSLFLSVLISCYRLHMHNEI 83  Candidatus Blo...
Q8PCR3          7 YLLSDFTQSFLATLIVLLVVSVGGVLVDILGNIADGRIPARLLLSQVGLQFVAYLPIILPLALMLGLLLALARLYRDSEM 86  Xanthomonas ca...
Q5NFC0          6 YYNKDIVNTFTSITLFIISIVSANLLIRLFQEAYSQGLGIDSIVKFVILTIPENVSLVAPIAIFLAIVICFGKYFANNEM 85  Francisella tu...
tigr:DNO_1152   9 YMMREISALFLAITMILLTIIISFRFSSLLSRALDGSVSLAAIGQLLIFQTANIVVILLPVAFILASVMTLSRLYGDCEI 88  Dichelobacter ...
Q82W93          7 YITRELLFPFIVVTVILIGLFVSFSVARFLTSAVTETLGTAAMFKLVGLKTIIALEVLVPIAFYVAVIYGLSRMNRDQEI 86  Nitrosomonas e...
WP_015480151   87 AAAKSAGVSLQRLVRPIGILAIALSGLNFLFLNNVFPYANLKQRNLYLNIKKKKPAL-ALVPGSFNADIPg-yQIKFDeK 164 Polaribacter s...
O84846         86 TFLKASGASQGMIIFPVLIASGVLCCFNFYTCSELASICRFQTGKEIANIAMTSPAL-LLQTLQ-KKENDr-iFIAID-H 161 Chlamydia trac...
Q31ET4         87 VVLQSCGIATSFFQKRVFWFLVPLAFLTAWVSLVVTPWSYEQERKLIMEAQTTSPLA-ALVPGKFNPLPNgegIFYTR-S 164 Hydrogenovibri...
jgi:Rmag_0478 101 IVMNSLGLGDKHFMVFIQPLVIVIVIFIFILTTVVVPWSKQQRGLIMERSENTPEFS-FIKKNEFQEFKNn-dIVFYA-S 177 Candidatus Rut...
Q8D296         86 ISIKTCGIGNECFIKVILFLNLLVMSFSFVNVMWISPLALNYKHKIISYNLSNIDKL-KLNEKQFKFIKDkniILFVD-N 163 Wigglesworthia...
Q7VQS9         84 LAMYSCAVNKYVLIQSICMYSTVIAILSLINLAYLAPHCEQYKENIFFKMKKNTYFIeLIEKKFYLLFDEh-lVLFID-N 161 Candidatus Blo...
Q8PCR3         87 AVITAIGIGPRRMLRPILWLVVPVVVVIGACSLWLGPWASRTAELMLEDANRSVVMA-GLESGKFTPLSGg-gVVYLT-T 163 Xanthomonas ca...
Q5NFC0         86 FVTIAGGITWMQIVKNTLKPVVALTIITLITVMYLNPLSKQTLDIYRASLSAKALLS-SITDQKIIKAPDg-kIIYIG-N 162 Francisella tu...
tigr:DNO_1152  89 NALFAGGCSKKHLMQPILYLVLPLAVILVINTLYLLPHVFERWDQLMAQSRQEALYS-FFTPNQFQHLNAh-nTLYTG-D 165 Dichelobacter ...
Q82W93         87 NVLRTAGYGDNRIIRTVFVIALPIAILSGILSVYARPWAYAESYIMDAQAEAELNTN-RFQPGRFYGSEKsgrVIFIR-G 164 Nitrosomonas e...
WP_015480151  165 YGEEENl-----LKKVWIYDLT--SN--RGNQKVITAESGKIVTEeg--srYMTFILYNGNYYEEHVKSarttikrkKma 233 Polaribacter s...
O84846        162 CGKSk-------FDNVVIALK---HN--QEISNIGFIETIIPDVNkdsvqaKNVLVISKIPLFSEAR----------Tsn 219 Chlamydia trac...
Q31ET4        165 IKSNGD------LESVWVRLNT--DE--RDILL--MAPKGKFEWIn----gKLVLVLLNGRSYEGLK----------Kgd 218 Hydrogenovibri...
jgi:Rmag_0478 178 KVSDADnakeqnMEEIFIYTLV--NN--EPVIT--LAKQAQKYTNfn--tnSVYLRLKNGTRYHGFPSNkn-----kKil 244 Candidatus Rut...
Q8D296        164 IKDKn-------LKNIFIVKFIlkNK--EYIPVVFVSKHGSLYKDll--knKNVINLNYGEYYEIDFKSn-------Yff 225 Wigglesworthia...
Q7VQS9        162 IKNGm-------LNHVFILKRV--QNidKNVFSIITADQGSIHYNfn--dkSQLIILQSGMYYEIHNTQll----ciPrf 226 Candidatus Blo...
Q8PCR3        164 ISPDGKg-----LGKVFMQRQ----K--DDRIDVVTAERGAMFFEgk---tDRYLRLEDGHRIEGPAGAqg-----lDyr 224 Xanthomonas ca...
Q5NFC0        163 KSGNt-------LSDVFLYQNT--PQ--DGEYKVMTAPTAKIVSDk----tAAYIDFMNVNIYTKNSQNs-------Eys 220 Francisella tu...
tigr:DNO_1152 166 KINNG-------FQPFIIIQ----ND--NNEYSMLWSKRGEIQKNq----pEHFLHLTQGNRAAWRDDF--------Qpq 220 Dichelobacter ...
Q82W93        165 KDDLEKr-----MEGVFHYI----RT--TEDREIIISREGYQQPMta--eqWPHIELREGQIYRLSFDTv-------Kds 224 Nitrosomonas e...
WP_015480151  234 assatfkeyefnidigdtldegQLDsinsatipmmltldqikdtipmlkdnydeilglraknifistsakdlyeypdslk 313 Polaribacter s...
O84846        220 pnefyletldeflipkitatlfAGK------------------------------------------------------- 244 Chlamydia trac...
Q31ET4        219 dftvrefdrfegflpeiqststAQQv------------------------------------------------------ 244 Hydrogenovibri...
jgi:Rmag_0478 245 nfklydlqiidgkmqksistvtKV-------------------------------------------------------- 268 Candidatus Rut...
Q8D296        226 iasferyqielfntfsrlkepsS--------------------------------------------------------- 248 Wigglesworthia...
Q7VQS9        227 vtyfnqyrtlvhdkyqflrdvnKSV------------------------------------------------------- 251 Candidatus Blo...
Q8PCR3        225 lmtfasndv--alpdrtkahdaNDP------------------------------------------------------- 247 Xanthomonas ca...
Q5NFC0        221 ydnakkaiyt-ifdnsdrdynhDRV------------------------------------------------------- 244 Francisella tu...
tigr:DNO_1152 221 nclfsqfahgslhlsqsppsaqQRL------------------------------------------------------- 245 Dichelobacter ...
Q82W93        225 airfekmiyf--------------------------------------------------------------------ne 236 Nitrosomonas e...
WP_015480151  314 nksldsniiDNFELQEKitilnsavtkttrvvstiNNNLDSIKWNRKM--VNFYD-TEYYNRVAFSLSCVILFFIGAPLG 390 Polaribacter s...
O84846        245 ---------SYMKT-----------------------RTDYLPWKQLIqdARLHL-AEILRRIAIGLLCSTMTFSGLALG 291 Chlamydia trac...
Q31ET4        245 ---------FEIPTSTL----------------------WQSDKPEHE--------ALLQWRIVTPFSILVLGLLGLKMS 285 Hydrogenovibri...
jgi:Rmag_0478 269 ---------ESKSTFEL------------------LF----SNKLTEI--------AEFQWRISQPLSILILSVLGVLLG 309 Candidatus Rut...
Q8D296        249 ---------EYVYFKNL-----------------------------FNscIEEYK-LEYNWRITIVFSVLIMSIISFALN 289 Wigglesworthia...
Q7VQS9        252 ---------KHMNINQL------------------------LISSELE------SyIELNWRLTLFISVFIMPMIAL-FV 291 Candidatus Blo...
Q8PCR3        248 ---------EVMSTFKL------------------------IGDARPI-----AR-AELHRRLAPPLLALAFALLTLPLS 288 Xanthomonas ca...
Q5NFC0        245 ---------DRLYMHTL---------------------IENFNDKNNG---TAYK-AEFLGRINNAISVIVSSLLALALC 290 Francisella tu...
tigr:DNO_1152 246 ---------RSIATGAL------------------------NQSLAHR--------AEFQKRLNPALAVVIFSFAVPLLA 284 Dichelobacter ...
Q82W93        237 ndqaqnyrrKAASTRSL---------------------------WDSE--EPREI-AELQWRLSRPVATVLLALIAVSFT 286 Nitrosomonas e...
WP_015480151  391 SIIRKGGFGLP-MILAIAVYVLYFFTNTFGKNLAEESSITSILGSWISAILMIPLA---I-------LLTN 450 Polaribacter sp. MED152
O84846        292 TYKPRFRK--P-VLIYALFPILNLIFLIVGKNTIHP--ISAVMLFLFPQLLSWLIF---Sw------RIyt 348 Chlamydia trachomatis
Q31ET4        286 KSGPREGRFAK-VFFALVLYVIYNQLLVTFRESISNEALSPWVGLWPIPVVFLMYA---Ly------QGSL 346 Hydrogenovibrio crunoge...
jgi:Rmag_0478 310 KTSPRSGKNLG-VLVGVVMFIVYNNVLLIAKSTLERGESSPIVGLWWVHLVMLLL----If------IFYK 369 Candidatus Ruthia magni...
Q8D296        290 IKKLGSGQFFN-LFLGIFFYLIFFISQTFIYSNHSLFKLHSIFFMWIINFIYIFFS---Ia------LYYN 350 Wigglesworthia glossini...
Q7VQS9        292 MMNIAYGYLSN-FLLAVVLYVFFYMLHIMLYTCSVLNYMNIIILMWIINCIYLIIL---LlmnvwesFRFK 358 Candidatus Blochmannia ...
Q8PCR3        289 RSAPRQQRYGR-IMLAFLAYLVGTNLMIVGTQWIANGKVPGALGLWWLTLPLLAVS---Iw------AYAR 349 Xanthomonas campestris ...
Q5NFC0        291 RLRPRQNKYAK-LLPSVVVLAIYLCTNMFINTLMANSSVPVWIGFWLPHIFFTIFA---Vr------TIRk 351 Francisella tularensis ...
tigr:DNO_1152 285 HTRPRQGRYQR-LLPAFILFGIYINLLDIALKMFSRGQIPFLIGGWGIHFAAAFIIaiyWq------RARK 348 Dichelobacter nodosus V...
Q82W93        287 RTAPRKDKTDRtFLVAALVFAVYYNLSGLAKTWVEQGVVAAMPGVWWVYGLLIIIV---Ml------RLPE 348 Nitrosomonas europaea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap