3WJM,3WJM


Conserved Protein Domain Family
Hemocyanin_N

?
pfam03722: Hemocyanin_N 
Click on image for an interactive view with Cn3D
Hemocyanin, all-alpha domain
This family includes arthropod hemocyanins and insect larval storage proteins.
Statistics
?
PSSM-Id: 397678
Aligned: 85 rows
Threshold Bit Score: 86.4046
Threshold Setting Gi: 195427301
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3WJM_F               34 FVEKQKKILSFFQDVSQLNTDDEYYKIGKDY--DIEMNMDnytnKKAVEEfLKMYRTG-FMPKNLEFSVFYDKMRDEAIA 110 domestic...
OWR53745             22 pkgdnqVVFQLTEQHLDDKYKSNGIEINNRFgkD-KPIIP----LKELKT-LPQFPKAkRLPSDADFSILLPAHQEMADE 95  Danaus p...
Q16G28               19 fmgKGKSVFDVPDNYLTDRYRPIGPEIQNRFgeLAEERIP----VRSIA--LPDLRIPmSLGRQEQFSLFIPRHRKIAAR 92  yellow f...
XP_001959110         19 FMDKAKTVFDVPDSFLTDRYRPISNEVQSRAgeQVEQRIP----VRDIS--IPDLRIPmSLGRDEQFSLFLPKHRRIAGR 92  Drosophi...
Q7PI00               21 pkddgKTVVDLPENYLTDRYKPIGQSLQTRFssEADTRIA----VRATT--LPDIRFAeELPRRGDFSLFIPKHRKIAGD 94  Anophele...
WGS:AANI:GJ22164-PA  22 trDNGKTVLDLPESVYTDRYRNNSEEVSNRFslNAETRIP----VRELAK-KPNLGFAsKLGRKNQFSLFNTRHREIAGQ 96  Drosophi...
EDW04434             22 trdNGKTVFDLPDSFYTDRYRNNSVEVATRFsqNVETRIP----LRELTS-VPNLDFAaKLGRKDQFSLFNTRHREIAGK 96  Drosophi...
XP_002066200         23 trDQGKTVLELPDSFYTDRYRNDADDVSNRFsqNVELKIP----IQELAR-KPNLDFAkKLSLKNQFSLFNSNHQDIAGK 97  Drosophi...
WGS:AAPP:GF13216-PB  23 trDNGKTVLELPDSFYTDRYKAESDQVGNRFskNVDVRIP----VQELAS-VPNLDFAkPLGPKKQFSLFNDQHRNIASE 97  Drosophi...
EDW48378             23 trdsGKTVLELPDSFYTDRYRNDTEEVGNRFskDVDLKIP----IQELSN-VPSLEFTkKIGLKNQFSLFNNRHREIASE 97  Drosophi...
3WJM_F              111 LFHLFYYAKD--FETFYKTACFARVHLNQGQFLYAFYIAVIQRSDCHG 156 domestic silkworm
OWR53745             96 VIDALLAVPEnqLPEFLSTCVYARVNLNPQLFNYCYSVALLHRKDTKN 143 Danaus plexippus plexippus
Q16G28               93 LIDIFMGMRN--IEELQSCAVFARDRINPYLFNYALSVALLHRRDTKN 138 yellow fever mosquito
XP_001959110         93 LIDIFMNMRT--VDDLQSVAVYARDRVNPVLFNYALSVALLHRPDTQG 138 Drosophila ananassae
Q7PI00               95 LIKLFLDQPD--VDTLMSVSSYARDRLNPVLYQYAMAVAIQHRPDTKN 140 Anopheles gambiae str. PEST
WGS:AANI:GJ22164-PA  97 LIQLYLDAPN--LQEFVALAVYTKDRVNPVLFQYSYAVAIAHRPDTRT 142 Drosophila virilis
EDW04434             97 LIQLYLDAPN--LQQFVALAAYTKDRVNPVMFQYSYAVAVAHRPDSRT 142 Drosophila grimshawi
XP_002066200         98 LIQLFLDAPN--LKQFVSLAAFTKDRLNPVLFQYAYAVAIAHREDTRE 143 Drosophila willistoni
WGS:AAPP:GF13216-PB  98 LITLFMNAPN--LRQFVSLSVFCKDRLNPMLFQYAYAVAIAHRKDTTE 143 Drosophila ananassae
EDW48378             98 LITLFMGAPN--LRQFVSLCVYTKDRVNPVLFQYAYAVAVAHRPDTRE 143 Drosophila sechellia
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap