4MO5


Conserved Protein Domain Family
AnmK

?
pfam03702: AnmK 
Click on image for an interactive view with Cn3D
Anhydro-N-acetylmuramic acid kinase
Anhydro-N-acetylmuramic acid kinase catalyzes the specific phosphorylation of 1,6-anhydro-N-acetylmuramic acid (anhMurNAc) with the simultaneous cleavage of the 1,6-anhydro ring, generating MurNAc-6-P. It is also required for the utilization of anhMurNAc, either imported from the medium, or derived from its own cell wall murein, and in so doing plays a role in cell wall recycling.
Statistics
?
PSSM-Id: 397660
Aligned: 8 rows
Threshold Bit Score: 488.433
Threshold Setting Gi: 81538701
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4MO5_D   2 PRYLGLMSGTSLDGMDIVLIEQGd----RTTLLASHYL-PMPAGLREDILALCVP-GPDEIARAAEVEQRWVALAAQGVR 75  Pseudomonas aeruginosa
P77570   4 GRFIGVMSGTSLDGVDVVLATIDe---hRVAQLASLSW-PIPVSLKQAVLDICQG-QQLTLSQFGQLDTQLGQLFADAVN 78  Escherichia coli K-12
Q9KU38   5 ELYIGVMSGTSLDGVDTALVALQd---dNIELLAHHDY-PIPADLKQRLLNVCIG-QPTTLIAMGELEHDLGHLFSDAVL 79  Vibrio cholerae O1 bi...
Q9CK07   6 MYYIGVMSGTSLDGVDLALMDFSc---aQPQLIHADFY-PMPPAIRQQISTLCNS-GTTTLQALGELDHQLGLLYTDCIQ 80  Pasteurella multocida...
Q9EWI9   1 MRVIGLMSGTSYDAVEAAAADLElegeaLVMRPLGHLSaPYPDGLRDLIADSLPP-AAATVRTVARLDTGIGQAFADVAV 79  Streptomyces coelicol...
Q9PGY0  14 PLYLGLMSGTSVDGIDAALVRINanaitHCELIAAQTS-AWDPNLRTTLLELSQGqNTASLDQLGWLDAQVGLAFATAAN 92  Xylella fastidiosa 9a5c
P44861   7 QYYLGMMSGTSLDGVDIVLVDFSq----DPQLILSDFF-PMPEDLREKLTTLIQV-GETTLQNLGELDHKLALLYSDCVN 80  Haemophilus influenza...
Q9K118   5 QLYIGIMSGTSMDGADAVLIRMDg---gKWLGAEGHAFtPYPGRLRRQLLDLQDT-GADELHRSRILSQELSRLYAQTAA 80  Neisseria meningitidi...
4MO5_D  76 ELLLQQQMSPDEVRAIGSHGQTIRHEPA-R--HFTVQIGNPALLAELTGIDVVADFRRRDVAAGGQGAPLVPAFHQALFG 152 Pseudomonas aeruginosa
P77570  79 ALLKEQNLQARDIVAIGCHGQTVWHEPT-GvaPHTLQIGDNNQIVARTGITVVGDFRRRDIALGGQGAPLVPAFHHALLA 157 Escherichia coli K-12
Q9KU38  80 ALLQHSGYRAEHIRAIGCHGQTVFHQPT-GtkPFTMQIGDANIIATRTGITTVADFRRKDVALGGQGAPLVPAFHRTIFH 158 Vibrio cholerae O1 bi...
Q9CK07  81 QFLQKHRLSPEQITAIGCHGQTVWHSPN-ShyPFTMQIGDANLIAAKTGITTVADFRRKDMAFGGQGAPLVPAFHQALFR 159 Pasteurella multocida...
Q9EWI9  80 RAVR--ELCGGAAGLVVSHGQTLYHWVEdGavRGTLQLGQPAWIAEATGLPVVSDLRGRDVAAGGQGAPLVAMTDVLAMA 157 Streptomyces coelicol...
Q9PGY0  93 TLIAKTGIKHTQIRAIGSHGQTIRHRPH-GdlPFTWQLGDAHRIAELTGITTVADFRRRDVAAGGQGAPLMPAFHLAILG 171 Xylella fastidiosa 9a5c
P44861  81 AFLQKNTFLPNQIQAIGCHGQTVWHSPN-SqfPFTMQLGDMNLLAAKTGISVIGDFRRKDMAWGGQGAPLVPAFHEAVFS 159 Haemophilus influenza...
Q9K118  81 ELLCSQNLAPSDITALGCHGQTVRHAPe---hGYSIQLADLPLLAERTRIFTVGDFRSRDLAAGGQGAPLVPAFHEALFR 157 Neisseria meningitidi...
4MO5_D 153 DDDTSRAVLNIGGFSNVSLLSPGKPVRGFDCGPGNVLMDAWIHHQRG--EHFDRDGAWAASGQVNHALLASLLADEFFAA 230 Pseudomonas aeruginosa
P77570 158 HPTERRMVLNIGGIANLSLLIPGQPVGGYDTGPGNMLMDAWIWRQAG--KPYDKDAEWARAGKVILPLLQNMLSDPYFSQ 235 Escherichia coli K-12
Q9KU38 159 AEQSTVVVLNIGGIANISVLKPNGEVVGYDTGPGNMLMDSWCQKERN--QPYDKDALWAKQGSVNAALLSHLKQDHYFAL 236 Vibrio cholerae O1 bi...
Q9CK07 160 KPNQATVVLNVGGISNISRLLPNEEVIGYDTGPGNTLLDAWIEKHQG--KAYDKNAEWAKSGKVNTDLLADLLDEPFFAL 237 Pasteurella multocida...
Q9EWI9 158 ALPGVPAALNLGGIANVTVVAPGAEPLAFDTGPANALMDAAVRHFTGgaAAFDEDGRRAGAGRVDPGLLRVLLDDPYYGR 237 Streptomyces coelicol...
Q9PGY0 172 SANENRAVLNLGGIANLTLIPMTGPVLGFDTGPANALLDSWYQRHHH--ETFDQSGNFAASGKINQKLLACLLADPWFTL 249 Xylella fastidiosa 9a5c
P44861 160 NSNFATAVLNIGGISNVSILFPNQAVIGFDTGPGNTLLDQWIEKHQG--LRYDENGEWAAKGNVNKVLLDELLNEPFFSL 237 Haemophilus influenza...
Q9K118 158 DNRETRAVLNIGGIANISVLPPDAPAFGFDTGPGNMLMDAWTQAHWQ--LPYDKNGAKAAQGNILPQLLDRLLAHPYFAQ 235 Neisseria meningitidi...
4MO5_D 231 RGPKSTGRERFNLPWLQEHLARHPal-pA---------ADIQATLLELSARSISESLLDAQPd-CEEVLVCGGGAFNTAL 299 Pseudomonas aeruginosa
P77570 236 PAPKSTGREYFNYGWLERHLRHFP----Gvd------pRDVQATLAELTAVTISEQVLLSGG--CERLMVCGGGSRNPLL 303 Escherichia coli K-12
Q9KU38 237 PAPKSTGRELFNLPWLETQLATFSvd-----------aTDVQRTLCEFTAQTIVEQVAPFAEgpQPQLLVCGGGAQNPLL 305 Vibrio cholerae O1 bi...
Q9CK07 238 PAPKSTGRELFNLAWLNKKLQKHt----All------pQDVQATLVELTAQSIVDQLNQIETelDRHLLVCGGGVKNCLL 307 Pasteurella multocida...
Q9EWI9 238 PAPKSTGKEQFHLPYLLAALAAAPv--aEp--------DDVLATLARLTAVTVADACRAHGVt---RLVVSGGGARNPVL 304 Streptomyces coelicol...
Q9PGY0 250 PPPKSTGREQFHLDWVTKQLEPTPp--sP---------ADVQATLLELTAVTVADALLRQQPk-TNRLLICGGGAHNPVL 317 Xylella fastidiosa 9a5c
P44861 238 PAPKSTGRELFNLVWLNHKIAKIRekltAlsvemsfrpEDVQATLVELTVTSIVNALNQLQTdlPKRLLVCGGGAKNSLI 317 Haemophilus influenza...
Q9K118 236 PHPKSTGRELFALNWLETYLDGGEn------------rYDVLRTLSRFTAQTVCDAVSHAAAd-ARQMYICGGGIRNPVL 302 Neisseria meningitidi...
4MO5_D 300 MKRLAMLMPE-ARVASTDEYGIPPAWMEGMAFAWLAHRFLERLPGNCPDVTGALGPRTLGALYPA 363 Pseudomonas aeruginosa
P77570 304 MARLAALLPG-TEVTTTDAVGISGDDMEALAFAWLAWRTLAGLPGNLPSVTGASQETVLGAIFPA 367 Escherichia coli K-12
Q9KU38 306 MERLQALLPS-WQVAPTTQMGVDGDNMEAMAFAWLAQRRIHGLPSNLPAVTGASRLASLGVIYYP 369 Vibrio cholerae O1 biovar El Tor str...
Q9CK07 308 MARLTALLPQ-WQVQTTNDYGLDADYVEAAAFAWLAYQRLNDLPGNLPSVTGAKSAVSLGAIYPK 371 Pasteurella multocida subsp. multoci...
Q9EWI9 305 MGMIAEELPG-VDLGSSDALGLPSDAKEALAFALLGFLTVNGLPGAIPSGTGARRASLLGSITPG 368 Streptomyces coelicolor A3(2)
Q9PGY0 318 MARLAAHLPN-VTVESIQTYGLNPDYLEAMGFAWLAAQTLDGQPGNLPSVTGARGLRLLGAIHPA 381 Xylella fastidiosa 9a5c
P44861 318 MRGLHDNLLD-WQVSTTTEQGFDIDYVEAAAFAWLAYCRINNLPANLPSVTGAKSAVSLGAIFPK 381 Haemophilus influenzae Rd KW20
Q9K118 303 MADLAECFGTrVSLHSTADLNLDPQWVEAAAFAWLAACWINRIPGSPHKATGASKPCILGAGYYy 367 Neisseria meningitidis MC58
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap