Conserved Protein Domain Family
UPF0181

?
pfam03701: UPF0181 
Uncharacterized protein family (UPF0181)
This family contains small proteins of about 50 amino acids of unknown function. The family includes YoaH.
Statistics
?
PSSM-Id: 397659
Aligned: 30 rows
Threshold Bit Score: 42.2695
Threshold Setting Gi: 254806585
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q65TM9               1 MFDNaLLSLSHEQQQQAVEKIQVLMQRGMSSGEAIALVAKELREAHDNEKI 51  [Mannheimia] succiniciproducens MBEL55E
dbsum:MEPCIT_160     1 MLNN-WLILTHHQQQKAVEHIQALIANSMSSSEAISLVASALRAEQLAKcs 50  Candidatus Moranella endobia PCIT
jgi:HSM_1330         1 MLNN--VKLTHEEQQSAVEKIQELMRQGMSSGEAIALVAKVLREKKLHPES 49  Histophilus somni 2336
jgi:Asuc_1722        1 MLDStLLGLTHAQQQQAVEEIQKLMSKGIPAGQAIKLVAEELRKQHEEKGK 51  Actinobacillus succinogenes 130Z
Q9KM20               1 MFDD-LPTLTHAEQQVAVEKIQKLMAEGISTGEAIKIVAQQIREDKKAQNQ 50  Vibrio cholerae O1 biovar El Tor str. ...
OXX61881             1 MFDD-IPTLSHQEQQEAVEKIQQLMAQGISTAEAIKIVASQIRAEKSADKT 50  Vibrio sp. V15_P4S5T153
Q87HP7               1 MFDD-LPPISHKEQQEAVERIQELMAKGTSTAEAIKIVADQIRAEYAAKQQ 50  Vibrio parahaemolyticus RIMD 2210633
Q7ME78               1 MFDD-LPPLSHQEQQRAVEEIQKLMAEGMSTAQAIKIIAEKIRAEHKAQSa 50  Vibrio vulnificus YJ016
CAV26445             1 MLND-LPTLSHEEQQKAVERIQEMMTQGISTAQAIKIVAEQIREEMSNKEe 50  Vibrio tasmaniensis LGP32
JLExeter:vfu_B00208  1 MFDD-LPTLSHAEQQAAVEKIQALMSQGISTAEAIKIIAQEIRQQQAEQQT 50  Vibrio furnissii NCTC 11218
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap