2QSB


Conserved Protein Domain Family
UPF0147

?
pfam03685: UPF0147 
Click on image for an interactive view with Cn3D
Uncharacterized protein family (UPF0147)
This family of small proteins have no known function.
Statistics
?
PSSM-Id: 397648
Aligned: 54 rows
Threshold Bit Score: 101.85
Threshold Setting Gi: 408364759
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QSB_A                 8 DQNLFNEVXYLLDELSQDITVPKNVRKVAQDSKAKLSQEN-ESLDLRCATVLSXLDEXANDPNVPAHGRTDLYTIISKLE 86  Thermop...
imbp:Hbut_1631         8 NEAKIRQAIMILMRIINDTAVPRNIRRAATEAIKQLRDES-LSPGVRAANAISILDEISQDPNMPVYARTLIWNVITLLE 86  Hyperth...
jgi:Igag_0474         26 NEAKIKQALLVLSRVMNDPSIPRNIRRAAMFAIRALNEKG-LSPGVRAANAVGILDEVSQDPNMPLHARTLLWSAITILE 104 Ignisph...
jgi:Igni_0760          8 NEAKIRQAKTMLMRVINDPAVPRNIRRACIEAVRHLENER-LSPGVRAANAISALDEIVQDPNMPIHTRITIWNVVTLLE 86  Ignicoc...
CBRAS:FFONT_1324      10 NEEKIKNAIVMLTKVVNDVSVPRNIRRVATDAINKLKDPS-LSPGVRAANAIQVLDEISQDPNMPVHTRITIWNIVSLLE 88  Fervidi...
A4YIC2                 7 NEAKIKQAIVLLQKVVNDTSVPRNIRRAASDAIRNLQDPS-LSPAVRAANATAILDEISQDPNMPSQTRISIWNVVSILE 85  Metallo...
Q4JAC6                 7 NEAKIRQAVGMLQKIVNDTSVPRNIRRAATDAIRNLQDQT-LSPAVRAANAIGILEEISQDPNMPMHTRIAIWNVVSMLE 85  Sulfolo...
BAJ49992               8 wESKRQQVVQILETIINDADTPRNIRRIAKQASTELFNEK-LRPAVRAANSIELIEEIINDPNMPSFTRTQLWMAISILE 86  Candida...
goetting:Ngar_c15550  13 NQERLARAIETLDSITKNSDIQKSIRNMIKEVLLALKDEKgGSVSVRAANAISLLDNATQSPQMQSHIRTMLWQVVSTLE 92  Candida...
jgi:Nmar_0307          7 NKESMKEAIETLNQIIGSNSTPKTIKKSITDLIADLNNEE-YSLSVRAANTISLLDDVTQDPNMPSYVRTQLWQAVSKLE 85  Nitroso...
2QSB_A                87 AL 88  Thermoplasma acidophilum DSM 1728
imbp:Hbut_1631        87 TV 88  Hyperthermus butylicus DSM 5456
jgi:Igag_0474        105 TV 106 Ignisphaera aggregans DSM 17230
jgi:Igni_0760         87 TV 88  Ignicoccus hospitalis KIN4/I
CBRAS:FFONT_1324      89 TV 90  Fervidicoccus fontis Kam940
A4YIC2                86 TI 87  Metallosphaera sedula DSM 5348
Q4JAC6                86 TV 87  Sulfolobus acidocaldarius DSM 639
BAJ49992              87 TI 88  Candidatus Caldiarchaeum subterraneum
goetting:Ngar_c15550  93 SI 94  Candidatus Nitrososphaera gargensis Ga9.2
jgi:Nmar_0307         86 SI 87  Nitrosopumilus maritimus SCM1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap