5IA8,6IZG


Conserved Protein Domain Family
Ufm1

?
pfam03671: Ufm1 
Ubiquitin fold modifier 1 protein
This is a family of short ubiquitin-like proteins, that is like neither type-1 or type-2. It is a ubiquitin-fold modifier 1 (Ufm1) that is synthesized in a precursor form of 85 amino-acid residues. In humans the enzyme for Ufm1 is Uba5 and the conjugating enzyme is Ufc1. Prior to activation by Uba5 the extra two amino acids at the C-terminal region of the human pro-Ufm1 protein are removed to expose Gly whose residue is necessary for conjugation to target molecule(s). The mature Ufm1 is conjugated to yet unidentified endogenous proteins. While Ubiquitin and many Ubls possess the conserved C-terminal di-glycine that is adenylated by each specific E1 or E1-like enzyme, respectively, in an ATP-dependent manner, Ufm1(1-83) possesses a single glycine at its C-terminus, which is followed by a Ser-Cys dipeptide in the precursor form of Ufm1. The C-terminally processed Ufm1(1-83) is specifically activated by Uba5, an E1-like enzyme, and then transferred to its cognate Ufc1, an E2-like enzyme.
Statistics
?
PSSM-Id: 397643
Aligned: 15 rows
Threshold Bit Score: 105.588
Threshold Setting Gi: 159119444
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5IA8_A        17 KVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATS-AIITNDGIGINPAQTAGNVFLKHGSELRII 91 
CDS42788       3 KVRFQITLTSDPNLPFKILDVPDSTPFTAVLKFVAEEFKVPPATS-AIITDDGIGINPNQNAGEVFLKHGGNLRLI 77  Echinococcus multil...
EEA07885      11 KVTFKITLASDRKNPYKILSVPEDTPFTAVVKFAAEQFKVSATTS-AIITMEGVGVNPNNTASQVFLKHGGDLQLI 85  Cryptosporidium mur...
B0G186         3 KVTFKITLTSDPKLPFRVINVTEDTPFTAVLRFACEQFNVPWQTS-AIITNDGIGINPAQTSGNIFLKNGSDLRLI 77  Dictyostelium disco...
EGC34201       3 KVTFKITLASDPKSPYKVISVPEATPFTAVLRFACEQFNVPWQTS-AIITEEGIGINPSQSAGNVFIKHSSNLKVI 77  Dictyostelium purpu...
XP_534489     70 KVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATS-AIITNDGIGINPAQTAGNVFLKHGSELRII 144 dog
EFC50448       8 KVTFKITLTSHPKQPFRTIKVPESAPFTAVLKYAAEEFQISAETS-AILSNDGIGINPSQTAGNVWLKYGTDLRII 82  Naegleria gruberi
XP_008185457   7 KVGFKITLTSDPKLPFKILKVPEAAPFTAVLKFAAEEFKVSPETS-AIITDDGIGINPQQTAGAVFLKHGTDLRLI 81  pea aphid
Q4N927         9 KVTFKIVLASDANQPYKVLSVPEQAPFSAVIKFAAEEFRLNPATC-AIITNDGVGINPTQTAGGVFLKYGSNLRLI 83  Theileria parva
Q57UL0        14 KVTFRIILTSERSQPFRVISIAEEAPLTAALRFAAEEFGIASVDSmAATTKDGTGINPAQTAGNVFMKYGQEIRLI 89  Trypanosoma brucei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap