Conserved Protein Domain Family
UPF0184

?
pfam03670: UPF0184 
Uncharacterized protein family (UPF0184)
Statistics
?
PSSM-Id: 112485
View PSSM: pfam03670
Aligned: 3 rows
Threshold Bit Score: 98.4847
Threshold Setting Gi: 20137722
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
O73881   1 MSGPNGDPNISVEDGLINDDDDFGSEEYEAINSMLDQINSYLDDLEERNDSLNGKLHELMESNRQARLEFRAQLSnHTPQ 80  torafugu
Q9BUW7   1 MSGPNGDLGMPVEAGAEGEEDGFGEAEYAAINSMLDQINSCLDHLEEKNDHLHARLQELLESNRQTRLEFQQQLG-EAPS 79  human
O97420   1 MSPKNNHDPSSSGDSGNTNVQEADLQEMEDVNNSLDALSCALDAVEQRTDDIMSQLRELLNSNREIRRLIAEEND-NAPE 79  fruit fly
O73881  81 EDSA 84  torafugu
Q9BUW7  80 DASP 83  human
O97420  80 SGDD 83  fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap