Conserved Protein Domain Family
Glyco_hydro_79n

?
pfam03662: Glyco_hydro_79n 
Glycosyl hydrolase family 79, N-terminal domain
Family of endo-beta-N-glucuronidase, or heparanase. Heparan sulfate proteoglycans (HSPGs) play a key role in the self- assembly, insolubility and barrier properties of basement membranes and extracellular matrices. Hence, cleavage of heparan sulfate (HS) affects the integrity and functional state of tissues and thereby fundamental normal and pathological phenomena involving cell migration and response to changes in the extracellular micro-environment. Heparanase degrades HS at specific intra-chain sites. The enzyme is synthesized as a latent approximately 65 kDa protein that is processed at the N-terminus into a highly active approximately 50 kDa form. Experimental evidence suggests that heparanase may facilitate both tumor cell invasion and neovascularization, both critical steps in cancer progression. The enzyme is also involved in cell migration associated with inflammation and autoimmunity.
Statistics
?
PSSM-Id: 397637
Aligned: 34 rows
Threshold Bit Score: 494.428
Threshold Setting Gi: 300155372
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EEF50783       30 VVQVTVRGLTSRASTDENFICATLDWWPDTKCDYGQCPWGQAGILNLDLENKILANAIKAFDPLRIRIGGSLQDQLVYQV 109  castor bean
XP_006345162   24 EIVLTIDASTKVAWTDANYICATIDWWPKEKCNYKQCPWGSASIINLDLTHPYLENAIRAFKGLRLRLGGSLQDQVIYGV 103  potato
XP_006354766   23 DTEFLIDGTVKIAETDDNYVCATLDWWPKEKCNYNECPWGSASLINLDLSHPFLANSIQAFNHLRLRLGGSLQNRIIYDV 102  potato
KRH56864       24 HGSILVDGIQAIAETDDNFICATIDWWPHDKCDYNYCPWGDSSAVNLDLSHPFFAKAIQALKPLRIRVGGSLQDQVLYEV 103  soybean
XP_010663310   24 DAIIKVDGATTVAETDANFICATLDWWPHDKCNYNHCPWGYSSVINMDLSHPLFAKAIEAFKHLRIRIGGSLQDQVLYDI 103  wine grape
Q8L608         26 RTTLVIDGSRRIAETDENFICATLDWWPPEKCNYDQCPWGYASLINLNLASPLLAKAIQAFRTLRIRIGGSLQDQVIYDV 105  thale cress
XP_006374165   24 RATISIDGTIAVAVIDDNFICATLDWWPHDKCNYNQCPWSYSSVTNLDLSHPLLAKAIQAFRNLRIRIGGSLQDQVLYDV 103  black cottonwood
ACV84153       27 EATVIVKGSTKIAETNKNYICATIDWWPPEKCNYNQCPWGQSSILNLDLDHPFLAQAIQAFDNLRIRLGGSLQDRVVYDV 106  long-grained ...
EEC69565      694 DVTIVVRGAETIASTSNEFICATIDWWPPEKCNYDQCPWGQASILNLDLTNPLLAKAIQAFSPLRIRLGGSLQDQVVYGT 773  long-grained ...
XP_009397277   23 yVTIIVKGSDIVAETDDSFVCATLDWWPPQKCNYNQCPWGQSSVLNLDLTHPFLSNAIQAFEHLRIRIGGSLQDQVVYGV 102  wild Malaysia...
EEF50783      110 GNYIKKFPHFKRRdgDDYLFGFTRGSLPMDRWDQINALFNQTGVKLTFGLNALIGKQKskdDGSILWVGDWDPQNARDFM 189  castor bean
XP_006345162  104 GNLKSPCSSFTQQ--KDGLFGFSRGCLPMQRWDELNNLFKKTGALVTFGLNALYGRQP---TNRHAWVGNWDSSNALDFI 178  potato
XP_006354766  103 GNLESPCHPFTKQ--GDELFGFSNGCLHMDRWDELNSFFNKTGALVTFGLNALRGRQR---TSKRVWEGNWDSSNAHDFI 177  potato
KRH56864      104 GSLKSPCHPFQKM--KGGLFGFSKGCLQMKRWDELNHFFDETGALVTFGLNALHGRHQ---ISHTVWGGDWDPSNAKDFI 178  soybean
XP_010663310  104 GSLRSPCHPFRKM--NDGLFGFSKGCLRMSRWDELNRLFSQTGVILTFGLNALYGRYQ---IRKGAWAGVWDSSNTQNFI 178  wine grape
Q8L608        106 GDLKTPCTQFKKT--DDGLFGFSEGCLYMKRWDEVNHFFNATGAIVTFGLNALHGRNK---LNGTAWGGDWDHTNTQDFM 180  thale cress
XP_006374165  104 ESLKAPCHPFRKM--KGGLFGFSKGCLHMNRWDELNHLFSRTGAIVTFGLNALYGRHQ---IRKGVWGGAWDSSNACDFM 178  black cottonwood
ACV84153      107 G-TNSPCTPFTNI--SNGLFGFSDGCLSMDRWDKLNALFQKTGAIITFGLNALYGRYN---VRRSFWAGKWNSTNAYNFV 180  long-grained ...
EEC69565      774 PNLGSPCTPFSKS--SSGLFGFSQGCITMERWDAINKIFMDTGAVVTFGLNALRGRQQ---MGRGVWGGAWNSSNAREFM 848  long-grained ...
XP_009397277  103 PTLGHPCLPFSKM--SGGLFGFSEGCLSMSRWDKLNLLFQRTGAIITFGLNALNGRHP---VHNGMWVGNWNSTNARDFI 177  wild Malaysia...
EEF50783      190 KYTISKGYHIDSYELGNELCGSGVSARLDAVEYGNDVIALRKLVNELYPDPNSRPAVLGPAGFYDQQWFNTFLMTVGPNV 269  castor bean
XP_006345162  179 KYTVAKGYQINSWEFGNELSGSGIGASVDAAQYGKDVIQLHNLLNQVYQNTPVRPLLLAPGGFYDPGWFGKLLQVSGRGT 258  potato
XP_006354766  178 YYTVSKGYQIHSWEFGNELSGKGIGAKVDAEQYGEDVIHLNNLIDQLYKHFQPRPLLLAPGGFYDKEWFETFLEVSGPGT 257  potato
KRH56864      179 NYTISKGYKIDSWEFGNELSGKGIGARVGAAQYGKDLIKLKEILRTLYKNSTFKPSLVAPGGFYNKEWFDKLLQVTGPGI 258  soybean
XP_010663310  179 KYTISKGYQIDSWEFGNELSGSGVGASVNAEQYGKDLINLKAIINKLYNNSNVKPLLVAPGGFYEQDWYAKLLQVSGSST 258  wine grape
Q8L608        181 NYTVSKGYAIDSWEFGNELSGSGIWASVSVELYGKDLIVLKNVIKNVYKNSRTKPLVVAPGGFFEEQWYSELLRLSGPGV 260  thale cress
XP_006374165  179 NYTVLKGYKIDSWEYGNELSGSGVSASVSAELYGKDLIKLKDVVNNLYKNSDLKPSLVAPGGFFDKQWYAKLLQVTGSGI 258  black cottonwood
ACV84153      181 KYTISKGYPVDSWEYGNELSGHGIGARVDATLYGKDAIELKSIFQQLYKAPLSQPSLLAPGGFFDQQWYTQLLQTSGHGV 260  long-grained ...
EEC69565      849 EYTVSMNYPIDSWEFGNELSGSGIGASVGAEQYGKDIIELKNIISQLYGNSR-KPLVVAPGGFYDQKWYAQLLDISGPNV 927  long-grained ...
XP_009397277  178 KYTISRGYPVDSWEFGNELSGSGVSARVSAEQYAKDLIGLKTLLKELYKNSRMRPLLVAPGGFFDQKWYTQLLQASGRDV 257  wild Malaysia...
EEF50783      270 VDGVTHHIYNLGAGVDKALINKIQDPYFLDQIAQTFKDVSDSVRQFGPWSGPWVGESGGAYNSGGKDVSHTFANGFWYLD 349  castor bean
XP_006345162  259 VNVLTHHIYNLGPGSDSKLVDKILNPEYLSRTEGTFSSLTQTILRNGPWASAWVGESGGAFNSGGPDVSNAFVDSFWYLD 338  potato
XP_006354766  258 VDALTHHIYNLGPGSDLNLVNKILNPLHLNKIADTFSNLIQTIEINGPWTSAWVGESGGAFNNGGPNVSNTFVNSFWYLD 337  potato
KRH56864      259 VNVLTHHVYNLGPGSDEHLDRKILDPECLSKVESIFSNLSETIQKYGPWSSAWVGEAGGAFNSGGRSVSNTFVNSFWYLD 338  soybean
XP_010663310  259 VNVVTHHIYNLGAGVDPNLVSKILNPHYLSRVEETFKSLDKTLQTWGPWASAWVGESGGAYNSGGHLVSNTFVNSFWYLD 338  wine grape
Q8L608        261 LDVLTHHIYNLGPGNDPKLVNKILDPNYLSGISELFANVNQTIQEHGPWAAAWVGEAGGAFNSGGRQVSETFINSFWYLD 340  thale cress
XP_006374165  259 VNFVTHHIYNLGAGMDPNLVNKILDPHYLSKVSETFSNLSQTIQQNGPWASAWVGESGGAYNSGGRHVSDTFVNSFWYLD 338  black cottonwood
ACV84153      261 VSALTHHIYNLGGGNDAHLIRKILDPKYLDRSEDTYRDMQLTLQRHGTWASAWVSESGGVFNNGGELVSNTFINSIWYLD 340  long-grained ...
EEC69565      928 LDAMTHHIYNLGAGNDPQVANRILNPQYLSQSSDTFRDLQMTIQRHGPWSAPWVGEAGGAYNSGSRKVSNTFLNSFWYLD 1007 long-grained ...
XP_009397277  258 VNALTHHIYNLGPGDDYRIESKILDPQYLSRITDTFRNLQLTIERHGPWSSAWVGEAGGAYNSGSRRVSNKFLDSFWYLD 337  wild Malaysia...
EEF50783      350 QLG 352  castor bean
XP_006345162  339 QLG 341  potato
XP_006354766  338 QLG 340  potato
KRH56864      339 QLG 341  soybean
XP_010663310  339 QLG 341  wine grape
Q8L608        341 QLG 343  thale cress
XP_006374165  339 QLG 341  black cottonwood
ACV84153      341 QLG 343  long-grained rice
EEC69565     1008 QLG 1010 long-grained rice
XP_009397277  338 QLG 340  wild Malaysian banana
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap