2HJ1


Conserved Protein Domain Family
Ub-RnfH

?
pfam03658: Ub-RnfH 
RnfH family Ubiquitin
A member of the RnfH family of the ubiquitin superfamily. Members of this family strongly co-occur in two distinct gene neighborhood contexts. In one it is associated with a START domain protein, a membrane protein SmpA and the transfer mRNA binding protein SmpB. This association suggests a possible role in the SmpB-tmRNA-based tagging and degadation system of bacteria, which is interesting given that other members of the ubiquitin system are analogously involved in protein-tagging and degradation across eukaryotes and various prokaryotes. The second context in which the RnfH genes are present is in a membrane associated complex involved in transporting electrons for various reductive reactions such as nitrogen fixation.
Statistics
?
PSSM-Id: 397633
Aligned: 168 rows
Threshold Bit Score: 80.9254
Threshold Setting Gi: 283473677
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2HJ1_A        13 INIEIAYA-FPERYYLKSFQVDEGITVQTAITQSGILSQFPEIDLSTNKIGIFSRPIK--LTDVLKEGDRIEIYRPLLAD 89 
CAP42854       7 lrVCVCHAeSAASAWQCSLELPAHATVGDAVQASGFAARFPGKDAWQLGVGVFGKLCR--ADTPLADGDRVEIYRPLDFD 84  Bordetella petrii
WP_043682527   1 MRVHIAFA-APTRLWRRTLDVPEGTTVGQALALSGFAEEFPEFTDHPPAMGVYGERCD--ARRVLREDDRVELYRPLVFD 77  Castellaniella ...
WP_013742128   5 ISIEVVYA-QAGAVWRVVVKMATGSTVEQALAASEFAERFPAYPQESLAVGIYGQVRK--LNQVLVDGDRIEIYRPLTFD 81  Pusillimonas sp...
A4XYG1         6 IAIEVVYA-LADRQKLLRLSVPVGTTVREAALRSGMQQFFPELDLHHAPLGIFGKAVAkpEERVLEEGERVEIYRPLIAD 84  Pseudomonas men...
BAN50664       6 IAVEVVYA-LADRQQLLRLSLPKGASARDAVLRSGMQAYFPELDLAGCPLGIFGKALPspEQRLLEEGDRVEIYRPLLVD 84  Pseudomonas res...
WP_013792691   6 LSVEVVFA-APDRQMLISLQLPVGATVREAALQSGLQAHFAELDLAGVPLGIFGKIVAspETQRLEEGDRVEIYRPLLAD 84  Pseudomonas fulva
P67259         2 LEIEIVYG-LPDRQVLKTMQLAEGTTVRAAALQSGLDGIFEDLNLHSAPLGIFGKAVK--DDTPLRDGDRIEVYRPLLID 78  Neisseria menin...
Q4KIH6         6 ISIEVAYA-AVDRQALIRVQVPQGSTLRAALQASAIGQQFPELDLAACPVGIFGKQVSdpEQHVIQAGDRIEVYRPLLAD 84  Pseudomonas pro...
Q87WN4         6 IQIEVVYA-TVQRQVLMTVDVPAGSSVRQALALCGMDREFPELDLSHCPVGIFGKVVAdpAARVLEAGERIEIYRPLLAD 84  Pseudomonas syr...
2HJ1_A        90 PKEIRR 95 
CAP42854      85 PKESRR 90  Bordetella petrii
WP_043682527  78 PLESRR 83  Castellaniella defragrans
WP_013742128  82 PMESRR 87  Pusillimonas sp. T7-7
A4XYG1        85 PKEVRK 90  Pseudomonas mendocina ymp
BAN50664      85 PKEVRK 90  Pseudomonas resinovorans NBRC 106553
WP_013792691  85 PKEVRK 90  Pseudomonas fulva
P67259        79 PKEARR 84  Neisseria meningitidis MC58
Q4KIH6        85 PKEVRR 90  Pseudomonas protegens Pf-5
Q87WN4        85 PMEIRR 90  Pseudomonas syringae pv. tomato str. DC3000
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap