Conserved Protein Domain Family
Virul_fac_BrkB

?
pfam03631: Virul_fac_BrkB 
Virulence factor BrkB
This family acts as a virulence factor. In Bordetella pertussis, BrkB is essential for resistance to complement-dependent killing by serum. This family was originally predicted to be ribonuclease BN, but this prediction has since been shown to be incorrect.
Statistics
?
PSSM-Id: 397612
Aligned: 102 rows
Threshold Bit Score: 68.8123
Threshold Setting Gi: 123044727
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Haur_2802     21 TVDDCSRMAASLAYYAVFSIFPLILLLLSIL-GFw-LRlqgdtNtNAEETLVNSLMQVfqtsp--------------qvg 84  Herpetosiph...
Q47BI3            23 YGENMMQTSAALAFTTLMALVPLVTVVLSVA-HAv-PY-----LdLVVARLDLMVREAl--------------------- 74  Dechloromon...
jgi:Pnuc_0979     22 RGQNLNQIAGGLAFTTTLSLVPMVTIATILI-SYl-PK-----ViQIKNAFKNWLLETy--------------------- 73  Polynucleob...
Q31EQ9            21 IKKEGLDAVTVLAYASLVGLVPFLTIIFSVF-SMs-GS-----FdSVQTDVMDKIMHYl--------------------- 72  Hydrogenovi...
Q30WT8            59 VADQCLLRASALTYTTVLSIVPTLAVAFSISkGLg-IQ-----NtEFIRVLLMRIAAG---------------------- 110 Desulfovibr...
WP_011770156      46 AEDKCMLRASALTFFSLLSMVPVAAMAFGIA-KGf-GF-----DkK---------LETllfd---------------nlq 94  Psychromona...
jgi:Anae109_4086  51 LDNRLTVRAAALTYYSILSVVPFLAFAFAVL-KGf-G-------------AYRTFIGEivrpylad--------tfganp 107 Anaeromyxob...
jgi:Plav_0931     45 LSGALSLRAMSLVYTTLLAMVPALAIAFAIF-RAf-GF-----DsYVEAVLTDFLSPLg--------------------- 96  Parvibaculu...
Q6AJ75            34 KQNKLSLRSSALTYTTLLSLVPILAMSTAVV-KGl-GG-----GdQLRNVAYS-YIQTlekaspaaaptdqgsdkstftt 105 Desulfotale...
WP_011985058      30 ESDTVRLRAMALTYITLFALVPALVVAFSVV-QAftGM-----D-RISDLVHEFLISNl--------------------- 81  Anaeromyxob...
jgi:Haur_2802     85 vDDS--AIrTALTEILKSLSQQAg--TNAPIALATTFFAASGIFVQIDKAFDVIWDIqpQQGNFlhtvksTLIERGKAFA 160 Herpetosiph...
Q47BI3            75 -LPVg-AA-GAIVGNIGKFSQKAq--NLTLVGLGGLSVTAFLLMNTIERAFNHLWRV---SPRP------ILARLRLYAF 140 Dechloromon...
jgi:Pnuc_0979     74 -MPGg-LN-EQVFIYLDQFSAQAr--GLTLLGLISLFITAIMTLSVIESAFNQIFKV--KLRRP------LHKKVAIYAT 140 Polynucleob...
Q31EQ9            73 -LPE--ST-PKVEFYLRQFSEKAr--ELQGVGIMVMLFIALILLWTVDKKINLMWSK--HLQRT------WWVSLLRYLG 138 Hydrogenovi...
Q30WT8           111 -RED--TV-TQILAYVDNTNVKT----LGAVGLLALFVTVGSLMGTIEKAFNSIWGV--ARGRT------LWRKFTDFFS 174 Desulfovibr...
WP_011770156      95 gQEE--VV-EKLIGFSQAMLENTqggIIAGIGTVVLFWAVIKVLGQIEESFNEIWGI--KKSRS------FARKFSDYVS 163 Psychromona...
jgi:Anae109_4086 108 aLHQ--AT-ERILEFVERTDVSR----LGALGLVVLVYTSVSLVSSIEVALNDVFGA--KTTRP------FLRQITDYVT 172 Anaeromyxob...
jgi:Plav_0931     97 -DEGtqIT-LQMMEFVNRVNVNI----LGTVGFAFLLYTVVSLINKVEAAFNSIWRV--EASRS------LARQFTEIVS 162 Parvibaculu...
Q6AJ75           106 hLRS--AV-KQVFDYVDRTNFAT----LGSFGMAGIILSVILVFSHIETAMNAIWKV--HSSRS------IMRKLSDYVT 170 Desulfotale...
WP_011985058      82 -AVG--AR-DTLEPYLQRFVSNAhatSAGIVGGALLVWSAISLFTNVDAAVNDIWGV--KRRRP------LSQQAVIYWM 149 Anaeromyxob...
jgi:Haur_2802    161 LVLVIGLLLISSLILSSVLQA--LENLsksfdLPGVGVg------WQIFTFATAFAINVLVFFLLFFAMPKPKMRWRDVL 232 Herpetosiph...
Q47BI3           141 VMAVWPFVLGAVAGVMSFAITssLGLFdepmwFRRIA--------LKVLATV----LLGLFFSFLYYAVPNAEVSRRAAL 208 Dechloromon...
jgi:Pnuc_0979    141 ATILGPILLGLGVYLSGILFSaae------gwTDSVSAg------FKLIATIAPIILAIIVYTVVYKVLPYAQISLSDAF 208 Polynucleob...
Q31EQ9           139 VSIIGPILLGFSLVLNSMLMAgp--------iF---PVlqeqtwaLNQAPVL----INILGFAFIYHFVPIHPVKVSYAF 203 Hydrogenovi...
Q30WT8           175 VTLVCPIVMAAAFSFSVSLRHetLVQKl----LNVGIVsy---ayVAFLKM-VPFLMIALMLFFIYVFIPNTRVRFGSAL 246 Desulfovibr...
WP_011770156     164 IMLICPVLLIISSSTTVIISSq-VTLLvekisFLGPivpl-iitsLKILPYA----VIWTVFTFIYIFIPNTKVNFKAGL 237 Psychromona...
jgi:Anae109_4086 173 LLVTTPILVFAAATISTAAQSssVIVFlrerlGLGPaid----faLGFTPVA----VVCLALFAMYTILPNVRVRPFSAL 244 Anaeromyxob...
jgi:Plav_0931    163 MSVLGPLLVLTVFGIMAGALSnsAIGGladnwLISYIIeq----sSRLVPYA----IVIAAFTFIYRMIPNTRVQMDAAL 234 Parvibaculu...
Q6AJ75           171 LLVLMPISINIAFAASAFLKSptLNSKidifvPFAWlqt----llFQFIPVF----FIALTLYVIYLFFPNTKVKNLPAA 242 Desulfotale...
WP_011985058     150 GITLGPLLLAGSLTLAATGRAflAGTGi---rAL-----------AVAGSAL----LTCAFFALVYLLVPYTKVRIKSAV 211 Anaeromyxob...
jgi:Haur_2802    233 PGAILTAALWEIGKIVLSLFLGG-NKYTAST-TVAAFIALLAWIYYASQIIFFGAEFCRVYTDWN 295 Herpetosiphon aurantiacus ...
Q47BI3           209 VGGVFAALAFAAMQKVFELFLVSsAMLKSIYgAFAAFPVFLVWLHLSWAVVLFGGLLAASVNRPG 273 Dechloromonas aromatica RCB
jgi:Pnuc_0979    209 SGGFFAALSFEAMKFGFAIFLTHtAFYKTVYgAFAILPLALLWIYLTWWITLAGAVLVANLPSIR 273 Polynucleobacter asymbioti...
Q31EQ9           204 IGALLASLELELLKFLFSFYVDWfPTVSIVYgAFAVIPLFLFWLYLLWFVIIFNASVVHQLTLER 268 Hydrogenovibrio crunogenus...
Q30WT8           247 LGGLVAGLLWTLAEGAYVGYQIGaARYNAIYgGFAQLPLFLIWVYVTWVIVLLGAEVSFAVQNVR 311 Desulfovibrio alaskensis G20
WP_011770156     238 LGGIIAGTTYQIVQWIYITFQVGvLKYGAIYgSFAALPLFLVWLQMSWLIVLLGAEVSFAEQNVE 302 Psychromonas ingrahamii
jgi:Anae109_4086 245 LGAAVAALGWQGALVLHVQLQMGvAKYNALYsVLSALPIFLVWSYVSWLIVLVGAEIAASHQNEQ 309 Anaeromyxobacter sp. Fw109-5
jgi:Plav_0931    235 VGGLVAGVTWGAAGWTFATFVVKsAQYVAIYsAFASLVFFMIWLYAAWIILLGGCSIAFYYQNRA 299 Parvibaculum lavamentivora...
Q6AJ75           243 LGALLAGSLWFFVQNIYIGLQIGvGNYNAIYgSFATVPLFLIWMYLGWVFILFGAQFAFAIQNRK 307 Desulfotalea psychrophila
WP_011985058     212 IAGLAAGVAWELAKWAYALGIGGiVRYHAIYgSVAAVPIFIFWLFVSWSIVLFGARLAFVIQYAT 276 Anaeromyxobacter sp. Fw109-5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap