Conserved Protein Domain Family
PapG_N

?
pfam03627: PapG_N 
PapG carbohydrate binding domain
PapG, the adhesin of the P-pili, is situated at the tip and is only a minor component of the whole pilus structure. A two-domain structure has been postulated for PapG; a carbohydrate binding N-terminus (this domain) and chaperone binding C-terminus. The carbohydrate-binding domain interacts with the receptor glycan.
Statistics
?
PSSM-Id: 112444
View PSSM: pfam03627
Aligned: 4 rows
Threshold Bit Score: 383.047
Threshold Setting Gi: 75468557
Created: 11-May-2020
Updated: 6-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9AIS9   1 MKKWFPAFLF-LSLSGGNDALAGWHNVMFYAFNDYLTTNAGNVKVIDQPQLYIPWNTGSATAT--YYSCSGPEFASG--V 75  Escherichia coli
Q9APE7   1 MKKWFPAFLF-LSLSGCNDALAGWHNVMFYAFNDYSGYDSGNMTIFDRGQFTIPWKTGAASAI--YSSCQTPEFVSG--V 75  Escherichia coli
Q9L6E1   1 MKKWLPAFLF-LSLSGCNDALAANQSTMFYSFNDNIYRPQLSVKVTDIVQFIVDINSASSTATlsYVACNGFTWTHG--L 77  Escherichia coli
Q47444   1 MKKWFPALLFsLCVSGESSA---WNNIVFYSLGDVNSYQGGNVVITQRPQFITSWRPGIATVT--WNQCNGPEFADGfwA 75  Escherichia coli
Q9AIS9  76 YFQEYLAWMVVPKHVYTNEGFNIFLDVQSKYGWSMENENDKDFYFFDNGYEWDTWTNNGARICFYPGNMNQLNNKFNDLV 155 Escherichia coli
Q9APE7  76 YFQEYIAWVLVPRSTQTTDRYTVFFDVYSKYGWNQENTGDYGYYYFLNGYEWDTWTSDGGRVCAPVGNTKQLSNTFNELR 155 Escherichia coli
Q9L6E1  78 YWSEYFAWLVVPKHV-SYNGYNIYLELQSKGGFSLDAE-DNDNYYLTKGFAWDE-VNSSGRVCFDIGEKRSLAWSFGGVT 154 Escherichia coli
Q47444  76 YYREYIAWVVFPKKVMTQNGYPLFIEVHNKGSWSEENTGDNDSYFFLKGYKWDERAFDTANLCQKPGEKKRLTEKFDDII 155 Escherichia coli
Q9AIS9 156 FRVFLPVDLPKGHYNFPCRYIRGIQHHYYDFWQDHYKMPYDQIKQLPATNTIDVSIDNVGECQPSTQVFNI 226 Escherichia coli
Q9APE7 156 FSLLLPADLPKGRYEVPIKYIRGIQHHYYNGWREHYKMPYSQVKQLPATNTLMLSFNNTGSCRPSAQSLEI 226 Escherichia coli
Q9L6E1 155 LNARLPVDLPKGDYTFPVKFLRGIQRNNYDYIGGRYKIPSSLMKTFPFNGTLNFSIKNTGGCRPSAQSLEI 225 Escherichia coli
Q47444 156 FKVALPADLPLGNYSVKIPYTSGMQRHFASYLGARFKIPYNVAKTLPRENEMLFLFKNIGGCRPSAQSLEI 226 Escherichia coli
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap