3S9O,3GM1


Conserved Protein Domain Family
Focal_AT

?
pfam03623: Focal_AT 
Focal adhesion targeting region
Focal adhesion kinase (FAK) is a tyrosine kinase found in focal adhesions, intracellular signaling complexes that are formed following engagement of the extracellular matrix by integrins. The C-terminal 'focal adhesion targeting' (FAT) region is necessary and sufficient for localising FAK to focal adhesions. The crystal structure of FAT shows it forms a four-helix bundle that resembles those found in two other proteins involved in cell adhesion, alpha-catenin and vinculin. The binding of FAT to the focal adhesion protein, paxillin, requires the integrity of the helical bundle, whereas binding to another focal adhesion protein, talin, does not.
Statistics
?
PSSM-Id: 397606
Aligned: 23 rows
Threshold Bit Score: 177.441
Threshold Setting Gi: 307767527
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3S9O_A         28 NLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETIPLLPASTHREIEMAQKLLNSDLG 107 
P70600        872 NLDRTDDLVYHNVMTLVEAVLELKNKLSQLPPEEYVVVVKNVGLNLRKLIGSVDDLLPSLPASSRTEIEGTQKLLNKDLA 951  Norway rat
XP_006010267  658 NLDRTDDKVYQHVMQMVKAVLQLKNEVYQLRPEDYVDVVKNVGLTLRTLISSVDEVLHSFPATSRTEIEGTMKLLNKDLA 737  coelacanth
XP_014328920  793 ELDRSGDEVYTGVMAMVKQVVQLKNEVNTLPASEYPTAVKAVGITLRSLIQSVDEILPSLHSSVTTEIEGTKKLLNKDLG 872  southern plat...
XP_007252087  808 ELDRSEDQVYHNVMEMVKVVVKLKNDVNTLPPSEYVGVVKAVGLTLRNLIHSVDEVLPSLHESIRTEIEGTQKLLNKDMA 887  Mexican tetra
Q7T2P8        860 ELDRSEDTVYQCVMDVVKVVVQLKNDINTLSSTEYISPVKTVGLSLRDLINSVDDILPTLHISCRTEIEGTQKLLNKDLA 939  zebrafish
XP_003455661  852 ELDRTDDKVYHCVMDLVKVVVELKNDIAGLQPEQYITHIKSVGMTLRDLIRSVDEILPTLHESVRTEIEGTQKLLNHDMG 931  Nile tilapia
3GM1_A         16 NLDRTDDLVYLNVMELVRAVLELKNELAQLPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLA 95  
RMC22509       29 DLDRTDDPVYGNVTDLVRAVLQLKNEISLVPPEGYILVVKNIGLSLRKLIGSVDDVLPDLPSSSRTEIEGTQKLLNKDLA 108  Hirundo rusti...
XP_026690958 1561 KLDREGDAVYRDTMLVVKAVLQANQEVMAAKPDEIFVLVKNIGKALKELCTSLDQETPHLPPEYHREIDMAQKTTNKDLS 1640 vase tunicate
3S9O_A        108 ELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKM 157 
P70600        952 ELINKMRLAQQNAVTSLSEDCKRQMLTASHTLAVDAKNLLDAVDQAKVVA 1001 Norway rat
XP_006010267  738 ELISKMKLAQQNAVTSLSEECKKQMLTAAHTLAVDSKNLLDAVDQARVRA 787  coelacanth
XP_014328920  873 ELINKMRLAQQNSVTSLKEECQKQMLAAAHTLALDSKNLLDAVDQARVRA 922  southern platyfish
XP_007252087  888 ELISKMRLAQQNAITSLKDECKKQMLAAAHTMAMDSKNLLDAVDQARVRA 937  Mexican tetra
Q7T2P8        940 ELISKMRLAQQNAITSLKEECKKQMLTAAHTLAMDAKNLLDAVDQARVRS 989  zebrafish
XP_003455661  932 ELISKMRLAQQNAITSLKEECKKQMLAAAHTLAMDSKNMLDAVDQARVRA 981  Nile tilapia
3GM1_A         96 ELINKMRLAQQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLA 145 
RMC22509      109 NLIGKMRLAQQNSGTSLSSEFRRQMLTASHALAVDAKNLLDAVDQAKLQA 158  Hirundo rustica rustica
XP_026690958 1641 QVINQMKLVKRFYSTTQVTDYKKCMMAATQVLAMDAKNLLDVVDKSRLqa 1690 vase tunicate
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap