Conserved Protein Domain Family
IBV_3A

?
pfam03617: IBV_3A 
IBV 3A protein
The gene product of gene 3 from Avian infectious bronchitis virus. Currently, the function of this protein remains unknown.
Statistics
?
PSSM-Id: 281600
Aligned: 2 rows
Threshold Bit Score: 66.9522
Created: 22-Mar-2022
Updated: 17-Oct-2022
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P30237  1 MIQSPTSFLIVLILLWCKLVLSCFREFIIALQQLIQVLLQIINSNLQSRLTLWHSLD 57  Avian infectious bronchitis virus (strain Bea...
P30237  1 MIQSPTSFLIVLILLWCKLVLSCFREFIIALQQLIQVLLQIINSNLQSRLTLWHSLD 57  Avian infectious bronchitis virus (strain Bea...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap