Conserved Protein Domain Family
DcuA_DcuB

?
pfam03605: DcuA_DcuB 
Anaerobic c4-dicarboxylate membrane transporter
Statistics
?
PSSM-Id: 397594
Aligned: 92 rows
Threshold Bit Score: 325.976
Threshold Setting Gi: 81673232
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_002987966     5 QFAILIAMILIGSQMKGIGLGVMGMVGLLIFVFIFQMKPGDPPIDVMLVIMAIVSTAATLQACGGLDYLVRLAERVIRSN 84  Myroides odor...
WP_015431874     5 EFLFLLVMLYIGSRYGGIGLGVVSGIGLAIEVFILRMPLGKAPVDVMLIILAVVTCASILEAAGGLKFMLQVAEKVLRKN 84  Bibersteinia ...
Q65RC6           5 EFLFLLLMLYTGSRFGGIGLGVISGIGLVIEVFILRMPLGKAPIDVMLVILAVVTCASILEAAGGLKYMLQIAERVLRSN 84  [Mannheimia] ...
Q6AJK5           5 QFLFLLVMLYTGSRYGGIGLGVVSGIGLTIEVFIFKMPPTSPPITVMLIILAVVTCASILEAAGGLKYMLQIAEKFLRAH 84  Desulfotalea ...
jgi:Dacet_1390   5 QFVFLLLMLYTGSRYGGIGLGVVSGIGLAVEVFIFGMAPTSPPITVMLIILAVVTCASILEAAGGLKYMLQVAERLLRSN 84  Denitrovibrio...
WP_015767469     8 QFVVVLGAIWMGARYSGVGLGLWGAVGLLVLIVGFGVTPTSPPIDVMLIILAVIMAASVMDAAGGIDFLVRVAERIIRAN 87  Candidatus Ac...
WP_015101010     9 ELLVVLGAIVMGTRSSGVALGLWGGLGVGVLVFVFREPAGTPPVDALLIVLAVVLAASMMQVAGGIDWMVRIAARVISRY 88  Saccharothrix...
Q8ZLD2           5 ELCFILVALMIGARIGGVFLGMVGGLGVGVMVFIFGLTPSTPPIDVILIILSVVLAAASLQASGGLDLLVKLAEKILRRH 84  Salmonella en...
ADO55696         5 ELLIIFLLIFFGARVGDVFMGLLGGVGVAIFVFIFHVQPAAPPIDVMLIILAVVLAASALQSSGGLNLLVQIAEKMLSKS 84  Paenibacillus...
CDC12293         5 EFIVLMLIIVWGTRKGGSFLAMAGGIGMLIFVYIFRVTPSDPPITVILIMLAVITAACTMQATGGLDFMVQLAEKILRKN 84  Roseburia sp....
WP_002987966    85 PSNIVFIAPFTVYFFCLFAGTAHLLYSLLPIIAEVATKKRIRPERPLSVSVIASHLAITGSPMSAATAAFAGasIL---- 160 Myroides odor...
WP_015431874    85 PKRITFLGPLVTYIMTFMLGTGHSVYSVMPIIADVALKNKIRPERPMAAASVASQLAITSSPLSAAVVYYLG--QIsglp 162 Bibersteinia ...
Q65RC6          85 PKRVTILAPMVTYVMTFMLGTGHSVYSVMPIIGDIALKNKIRPERPMAVSSVASQLAITSSPLSAAIAYYLT--QItkmp 162 [Mannheimia] ...
Q6AJK5          85 PTRITLFGPLVTYIMTIMLGTGHAVYSVMPIIGDVALKNNIRPERPMATASVASQLGITASPISAAVVYYLS--QLsg-- 160 Desulfotalea ...
jgi:Dacet_1390  85 PRRITILGPLVTYTMTFMLGTGHAVYSIMPIIGDVALKNNIRPERPMAAASVASQLGITASPISAAVVYYLS--QLsn-- 160 Denitrovibrio...
WP_015767469    88 PKYVTIVAPLTTWSFSFVAGTGHIVYPLLPVIYETAHQNGIRPERPMAVATIASQQAITASPVAAATAAMIG--LF---- 161 Candidatus Ac...
WP_015101010    89 PRQITLIAPLVTFLFSVGAGTSNILYPLLPVISDVAYRNGERPSRPLSLSVVATGVALACSPVSAAMAAMVTltDV---- 164 Saccharothrix...
Q8ZLD2          85 PRYITLLAPFICYIFTFMSGTGHVVYSLLPVISEVARDSGIRPERPLSISVIASQQAITASPISAAMAAMIG--LM---- 158 Salmonella en...
ADO55696        85 PKNITIIAPIISWLFTFLSGTGHVVYSLLPIINKLAIDNDIRPERPISNSIIASQQAVTCSPVSAATAAMIG--FM---- 158 Paenibacillus...
CDC12293        85 PKNITLVAPFVAYLFTFCCGTGHIVYSLLPVINEIALENGIRPERPISVSIISSQQANTGSPITAATVAIVG--YM---- 158 Roseburia sp....
WP_002987966   161 AYPG-A---LIDIMKVCIPACLIGILITCLVVLRKGKELKDDPIFIEKMKDPEFAKSLDA-DEDASGNKkplkkgAKTSV 235 Myroides odor...
WP_015431874   163 GFEHvS---LLSIIGVTVPATLAGTIAMSLYSLRRGKELENDPEYQRRLQDPVWRDRIAN-TT-STTLNdtlpagAKQAV 237 Bibersteinia ...
Q65RC6         163 GYEHiT---LLNIISVTVPATFVGTMAMALYSLRRGKELEDDPEYQRRLKDPTWRDRILN-TT-ATSLDaelprsAKMAV 237 [Mannheimia] ...
Q6AJK5         161 gsEHiT---LLSILAITVPGTFIGLLAMVAVTWRRGKNLADDKGFQKRMEDPAFRERVET-TT-ATSLDetlptsARNAV 235 Desulfotalea ...
jgi:Dacet_1390 161 inPNiT---LLTILSVTVPSTLCGCIAMSIYSLRRGKELKDDKEYQKRLQDPVWGERIRN-TT-ATTLDevlptsARNAV 235 Denitrovibrio...
WP_015767469   162 AEKGlNawgLPEILMICVPATLAGVVAAAFISMFLGEDLKDDPEYQARLLAGQIPVPKAA-SDRPPLKPa-----ARLSA 235 Candidatus Ac...
WP_015101010   165 DPYRfE---LIDIVKVTLPAAVLGIVASFFVVRRLGKDVADDPEIQARVASGELPPASPG-STRGLPEAtp---tGRAAA 237 Saccharothrix...
Q8ZLD2         159 APLGvS---ISTIMMICVPATLIGVAMGAIATFNKGKELKDDPEYQRRLAEGLIKPAQKE-SKNTVVTSr-----AKLSV 229 Salmonella en...
ADO55696       159 SPLGvS---LGTILAISIPATLLGVITSAVCTLRKGKELSEDSEYLHRLAEGLIEKSEKK-AEKKETSKg-----AKAAV 229 Paenibacillus...
CDC12293       159 --TIfEkvnLATIMLVAIPAALIGVLVAALSVYKKGLELEDDPEYQQRVADGLVKDFKKKvEGEKQVTKk-----AKISV 231 Roseburia sp....
WP_002987966   236 VIFAIAVLLIVIAGAFPQLLPQFepgaaslvvKANGELQMVSVISMITLSASALMMLITKTSAISVTKVSLFSSMATAVV 315 Myroides odor...
WP_015431874   238 YLFLLALVVIVAIAMFPEIRTVGe-------gEKVKPIGMSLIIQIMMLCFGGLILILTRTNPQTVPNGVVFKSGMVAAI 310 Bibersteinia ...
Q65RC6         238 WLFVLSLVTVVVIAMLPEIRTVGvpv----dgKPVKAISMSFIIQMMMLCFGGIILIATKTNPQSVPNGVVFKSGMVACI 313 [Mannheimia] ...
Q6AJK5         236 LLFLLALVVIVIIAMIPEIRTLQ---------PGTKPLSMSVIIQMMMLAFGGIILIATGTKASKVPEGVVFKSGMVAAI 306 Desulfotalea ...
jgi:Dacet_1390 236 LIFLLALVTIVIIAMVPSIRTLA---------EGQKPIAMSVIIQMMMLAFGGLILIVTKTKTNKVPEGVVFKSGMVAAI 306 Denitrovibrio...
WP_015767469   236 FLFLAGVALVVLFGFFPELRkl---------pGAKSALGMPIVIEVVMMAVAAIMLMLTRVNVDEIPRTATLRAGVVAVI 306 Candidatus Ac...
WP_015101010   238 LVFLSGVLVIVVLGLFKDLRPED---------ARGAELGMTPIIEMVMFAVGTVILVIARPKVADVPMASVFRAGMVSAI 308 Saccharothrix...
Q8ZLD2         230 ALFLTSAIVIVLLGLIPALRPMVet------aKGLQPLSMSAAIQITMLSFACLIVLLCRPQVDQIISGTVFRAGALAIV 303 Salmonella en...
ADO55696       230 VLFLMGVLAIVIMGMFTQLRPSWvl------nGEVTSLSMPHTIEMIMLVCATMIIIVCRPAIETILNGPIFRAGALAMV 303 Paenibacillus...
CDC12293       232 AIFLVSMVVIAICGIFPALRPTF---------SDGTQLAMTSLIQIIMYVAAAIIVIVSKIDSNDILEVPLLKTGFFAVI 302 Roseburia sp....
WP_002987966   316 SVFGVVWMSATFMSHNEVAIKGFLSEVVTLYPWTFAIAVFVLGALMFSQAATTKTMMPLGMALGVS 381 Myroides odoratus
WP_015431874   311 AIFGIAWMSDTYFQYAMPQFKAGITEMVENYPWTFAFALFAVSVVINSQAATAVMMLPVGIGLGLP 376 Bibersteinia trehalosi
Q65RC6         314 AIYGIAWMSDTYFSYAMPEFKAAVTTMVESYPWTFAFALFAVSVVINSQAATAVMMLPVGISLGLP 379 [Mannheimia] succiniciprodu...
Q6AJK5         307 AIFGIAWMSDTYFHYAMPSFKEGITQMVQTLPWTFALAMFAVSVVVNSQAATCRMMLPVGIGLGLS 372 Desulfotalea psychrophila
jgi:Dacet_1390 307 AIFGIAWMSDTYFQHAMPSFKVGITAMVQDYPWTFALAMFIVSVVINSQAATCRMMLPVGLGLGLP 372 Denitrovibrio acetiphilus D...
WP_015767469   307 GIFGLAWLGDSFIAAHKDVIVPAIGHWAEVAPWTFAFGLFFASVLLYSQAATTRALMPLGIALGIP 372 Candidatus Accumulibacter p...
WP_015101010   309 ALFGLAWLTDTFISAHQALVVDTVGRWVDAAPWIFALGVFLVCVATTSQSTATRTIVPIGLAAGLA 374 Saccharothrix espanaensis
Q8ZLD2         304 CAFGLAWMSETFVNGHIALIKAEVQTLLQQHTWLIAIMMFFVSAMVSSQAATTLILLPLGLALGLP 369 Salmonella enterica subsp. ...
ADO55696       304 CAFGLAWMSSTFITGQSAFIQDHVATIVNSHPWMLAVIMFIVAALTTSQGVTTLIMIPIAIALDLP 369 Paenibacillus polymyxa SC2
CDC12293       303 LAAGLCWLVNTFVGAQTDFITENLSALTNKYPWIYIIAVFLVGALTSSQASTTMIMIPIAIALKLP 368 Roseburia sp. CAG:45
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap