Conserved Protein Domain Family
Cons_hypoth698

?
pfam03601: Cons_hypoth698 
Conserved hypothetical protein 698
Statistics
?
PSSM-Id: 397590
Aligned: 12 rows
Threshold Bit Score: 231.026
Threshold Setting Gi: 51316911
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9PNU1  18 KGLLFTACIVIFAMY-------LSSvqsiKDTTHLAATAFAIIIGVLLSp-wFFKYQHHFQAGVHFSAKKLLRLGIVLYG 89  Campylobacter jejuni ...
Q9CII5   5 PGFLLSFAIAIVSYL-------LNR----FIFHSLGSATIAILLGIILGn--LYFKQVTLFAGTAWSEKKLLEFSVMFLG 71  Lactococcus lactis su...
Q99ZV5   9 PGLLLCLLLALPAWC-------LGR-----LFPIIGAPVFAILLGMLLAl--FYEHRDKTKEGISFTSKYILQTAVVLLG 74  Streptococcus pyogene...
Q8DRN6   9 aGILACLLISILSWY-------LGG-----FFPVIGAPVFAIFIGMLLHp--FLSSYKQLDAGLTFSSKKLLQYAVVLLG 74  Streptococcus pneumon...
Q73Y38  67 PGILLLIGVGVLGKYaqiwwnaLAKhe-hWTVPDIEYVLWAIVIGLVITn--TVGLHPIFRPGVLTYE-FWLKAGIVALG 142 Mycobacterium avium s...
Q9AB09 147 PGLLAGLLMAVLAKL-------LSQs------LHAPAPLLAVVLGMMLG---ALGLQGQLGAGLDVFAKPGLRLGVAMMG 210 Caulobacter vibrioide...
O28652  22 QMLLLLLLCGAAAYI-------INLa-----dPALEPLFLALVFGIVAGn---LQRDEEKKRVVERYVPFLLPIGITLYG 86  Archaeoglobus fulgidu...
Q9HTI1  21 PGLLLSAALAGVAIL-------LGRsq-wLQHNGISALTLAIVLGILVGntlYPRIAAGSAAGVGFSKQILLRAGIILYG 92  Pseudomonas aeruginos...
Q9CKY9   8 LGLVFIGILTFLVNL-------LAKtp-fALNANLSALTIAILLGILFGntfYPKISQYTAQGVIFAKGTLLRLGIILYG 79  Pasteurella multocida...
P45290   8 FGLIFIAIIAVLANY-------LGStd-fSHHYHISALIIAILLGMAIGntiYPQFSSQVEKGVLFAKGTLLRAGIVLYG 79  Haemophilus influenza...
P62723  18 PGLALSAVITGVALW-------GGSip-aVAGAGFSALTLAILLGMVLGntiYPHIWKSCDGGVLFAKQYLLRLGIILYG 89  Escherichia coli K-12
Q2G134  11 iGLSLTFIVALFSFL-------AAKl---pILDKVGALTIAILIAILYRh--FRGYPEQYSSGITFSSKYLLRFAIILYG 78  Staphylococcus aureus...
Q9PNU1  90 FNITLTELLSVGLKGFLLSAIVIFFVFIIALFVGtKIFKLDKETSMLVGAGSAICGAAAVLALESSLKSDPFK---GILA 166 Campylobacter jejuni ...
Q9CII5  72 ATVTFQTIGKLGFSGVGFILIQMISTIIFVLFMG-KKLGFSANVSALMASGNAVCGSSAIAAVEPVIGAETSE---KRTS 147 Lactococcus lactis su...
Q99ZV5  75 FGLNLTQVMAVGM-QSLPIIISTIATALLVAYGLqKWLRLDVNTATLVGVGSSICGGSAVAATAPVIKAKDDE---VAKA 150 Streptococcus pyogene...
Q8DRN6  75 FGLNISQVFAVGQ-SSLPVILSTISIALIIAYLFqRFFALDTKLATLVGVGSSICGGSAIAATAPVIHAKEKE---VAQA 150 Streptococcus pneumon...
Q73Y38 143 SRFVLGDIAKLGG-ISLVQILVDMTIAGTIIIAVaRWFGLSGKLGSLLAIGTSICGVSAIVAAKGAIRARNSD---VSYA 218 Mycobacterium avium s...
Q9AB09 211 AQISWSEFAALGGPAVLASGAVVLGGLGIGALAG-AALGLPLAEALIAAAACSICGASAALAASQAAPSSPENqrtTALV 289 Caulobacter vibrioide...
O28652  87 VNINIPYLGEFHPEIVAATLISTSLIFLTVFWLS-SRLKLSRQMSILLACGSGICGVSAIAIISPLIKPRKEE---FSAA 162 Archaeoglobus fulgidu...
Q9HTI1  93 LRLTFQDIAGVGLHGVLLDALMLASTFGLACLLGtRLFGLDRTTTLLIGAGSSICGAAAVMATEPVVRGRAEQ---VAVA 169 Pseudomonas aeruginos...
Q9CKY9  80 FRLTLQDISNVGINAIATDTIMLISTFLLTLWLGiRYLKMDKQIVYLTAGGCSICGAAAIMSMQPVTKAESHH---VSIA 156 Pasteurella multocida...
P45290  80 FRLTFGDIADVGLNAVVTDAIMLISTFFLTALLGiRYLKMDKQLVYLTGAGCSICGAAAVMAAEPVTKAESHK---VSVA 156 Haemophilus influenza...
P62723  90 FRLTFSQIADVGISGIIIDVLTLSSTFLLACFLGqKVFGLDKHTSWLIGAGSSICGAAAVLATEPVVKAEASK---VTVA 166 Escherichia coli K-12
Q2G134  79 LKLNIFDIIGQGSKLLAIDVGVVIFSIVMMLFVN-KLLHGDKNIALLLGVGTGVCGAAAIAAVAPIFKSREKD---TAIS 154 Staphylococcus aureus...
Q9PNU1 167 VGTVVIFGLVFMFLYPIAFSLNLFPff---dQNAMGVFMGATLHEVANVAGAAEMAKDMAGFeqgasnVAVIIKMMRVIL 243 Campylobacter jejuni ...
Q9CII5 148 IAMVNLMGTILMLSLPFLGTWMFGNn-----DLLRGALIGGTEQSVGQVVASATMVNPNTTT------LATLFKIMRIIM 216 Lactococcus lactis su...
Q99ZV5 151 ISVIFLFNMLAALLFPSLGQLLGLS------NEGFAIFAGTAVNDTSSVTATATAWDALHHSnt--ldGATIVKLTRTLA 222 Streptococcus pyogene...
Q8DRN6 151 ISVIFFFNVLAALIFPTLGTWLHLS------NEGFALFAGTAVNDTSSVTAAASAWDSLYQSnt--leSATIVKLTRTLA 222 Streptococcus pneumon...
Q73Y38 219 IAAILALGAVSLFVLPPLGHAIGLT------DHEFGLWAGLSVDNTAETTATGYLYSEHAGK------IAVLVKSTRNAL 286 Mycobacterium avium s...
Q9AB09 290 IVGVNLLSTVAMLAYPPIANALGLT------AHQAGVFFGLSIHDVAQVAGAGASVSPEVAG------TAALAKLSRILW 357 Caulobacter vibrioide...
O28652 163 IMIITAVGLTGAILYPSIAHYASIS------PDEFAVLAGATLHQTGIVKISSQLFGVEEEA------LAIKG--IRIAM 228 Archaeoglobus fulgidu...
Q9HTI1 170 VSTVVVFGTLGIFLYPALFQLDQDWgllprdPGTWGVYIGATVHEVAQVVAAGRSIGIEAAD------TAVIAKMVRVMM 243 Pseudomonas aeruginos...
Q9CKY9 157 VAVIVIFGTISMFLYPLMYPYLATWl----nEHQFGIYIGSSVHEVAQVYAAGGNISPAVAD------TAVISKMIRVMM 226 Pasteurella multocida...
P45290 157 IAVVVIFGTLSIFTYPFFYTWSQHLi----nAHQFGIYVGSSVHEVAQVYAIGGNIDPIVAN------TAVITKMLRVMM 226 Haemophilus influenza...
P62723 167 VATVVIFGTVAIFLYPAIYPLMSQWf----sPETFGIYIGSTVHEVAQVVAAGHAISPDAEN------AAVISKMLRVMM 236 Escherichia coli K-12
Q2G134 155 IGIIALIGTIFSLIYTAIYAIFSMT------TNVYGAWSGVSLHEIAHVVLAGGFGGSDALK------IALLGKLGRVFL 222 Staphylococcus aureus...
Q9PNU1 244 LVPFLLIVTY--FFAKNQHSSSGKTAk--SIT-----IPYFAFAFLGMIVLNTYLASKesilgiatSDIISLGKTLCTLC 314 Campylobacter jejuni ...
Q9CII5 217 LVFVVLYFGFrsKKQKRNEQGPTQIKikrNSF-----LPWYVLGFLVLCTLDTLIHFV--------PEVSATAKFLSGWC 283 Lactococcus lactis su...
Q99ZV5 223 ILPITLGLSL--YRAKKEHDIVTEENfslRKS-----FPRFILFFLLASLITTLMTSLgv-----sADSFHYLKTLSKFF 290 Streptococcus pyogene...
Q8DRN6 223 IIPITLFLSY--WQSRQQENKQSLQL---KKV-----FPLFILYFILASLLTTLLTSLgv-----sSSFFTPLKQLSKFL 287 Streptococcus pneumon...
Q73Y38 287 IGFVVLGFAL--FWAGRGQADEIAPGvraKAAfiwakFPKFVLGFLVVSAIATAGWLT--------KGQTANLANVSKWA 356 Mycobacterium avium s...
Q9AB09 358 LGPAVVLIGL--MLTRTAQGGRISG----LQA-----PPLFVWGFAALAAARGLNLIP--------PALVSALGACSGFL 418 Caulobacter vibrioide...
O28652 229 IALVVLILS----IIYSES----------RFY-----VPWYIVSFLGVALFSSTYLPG---------EVVQALRPLATVM 280 Archaeoglobus fulgidu...
Q9HTI1 244 LAPFLILLSA--WLARDKAHRRQHSGa-tKIT-----IPWFAVGFVLVAGLNSLVSLP--------PALVSHVNDLDTFL 307 Pseudomonas aeruginos...
Q9CKY9 227 LAPFLLLVSW--LLTKQNDQAKTTN-----IS-----IPWFAFLFILMAVINSFSLIP--------AHIVAWIVEIDSLL 286 Pasteurella multocida...
P45290 227 LAPFLFMLSW--LLTRSDGISENTSH---KIT-----IPWFAVLFIGVAIFNSFDLLP--------KELVKLFVEIDSFL 288 Haemophilus influenza...
P62723 237 LAPFLILLAA--RVKQLSGANSGEKS---KIT-----IPWFAILFIVVAIFNSFHLLP--------QSVVNMLVTLDTFL 298 Escherichia coli K-12
Q2G134 223 LIPLTIVLIL--IMRFRSSESSSKG----RIS-----IPYFLIGFVIMALVNTYVTIP--------SALLNILNTVSTIC 283 Staphylococcus aureus...
Q9PNU1 315 IVFAMAALGLQIDFKKFLKSGSRVFGLA 342 Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Q9CII5 284 ETIALAAIGLRLNLVEFIKAGKKLLIYG 311 Lactococcus lactis subsp. lactis Il1403
Q99ZV5 291 IVMAMAAIGLNTNLVKLIKTGGQAILLG 318 Streptococcus pyogenes serotype M1
Q8DRN6 288 IVMAMSAIGLKTNLVAMVKSSGKSILLg 315 Streptococcus pneumoniae R6
Q73Y38 357 FLLTFAGVGLNTDIRQIARTGWRPLVVA 384 Mycobacterium avium subsp. paratuberculosis K-10
Q9AB09 419 LLAGVGAISAKLGPKALLEVKPRLAILL 446 Caulobacter vibrioides CB15
O28652 281 FATTLAAICYTVNVGRVQRVGVKPLFAS 308 Archaeoglobus fulgidus DSM 4304
Q9HTI1 308 LAMAMAGLGLGTHLSAIRRAGLKPLLLA 335 Pseudomonas aeruginosa PAO1
Q9CKY9 287 LIAAMTALGLTTHISAIKQAGIKPLILG 314 Pasteurella multocida subsp. multocida str. Pm70
P45290 289 LISAMAALGLTTQASAIKKAGLKPLVLG 316 Haemophilus influenzae Rd KW20
P62723 299 LAMAMAALGLTTHVSALKKAGAKPLLMA 326 Escherichia coli K-12
Q2G134 284 LLMAMVALGLNVAFKDLKNRALKPLMTi 311 Staphylococcus aureus subsp. aureus NCTC 8325
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap