4DJF


Conserved Protein Domain Family
CdhD

?
pfam03599: CdhD 
Click on image for an interactive view with Cn3D
CO dehydrogenase/acetyl-CoA synthase delta subunit
Statistics
?
PSSM-Id: 397588
Aligned: 9 rows
Threshold Bit Score: 318.715
Threshold Setting Gi: 38502839
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4DJF_E  63 KVVLGA-------GPTAVEMGDETELF--RHDKRFYHETAIAIQVSDNLSSEELKAKVEAINGLNFD-------RVGQHY 126 Moorella thermoacetica
Q57576  69 EVWFGN-------EEKKAVMGGDEVMY--RYQLSFFNPTPIGVDISDELSEEEIKNRAKEIENFVFE-------RTGEKL 132 Methanocaldococcus ja...
O27748  63 EITFGP-------EENQVVVGGDEVLY--RYELTYYNPTALVVDLPDDLPSEELLNRAQRIMELEFE-------RTGEKL 126 Methanothermobacter t...
Q50539  69 QVTIGV-------GEKAANIGGDDVLY--RHKLTFFNKTKMFFDVSDNMEED---ALIERVKKIADfk----kfYVGRNL 132 Methanosarcina thermo...
O29871  73 EVVIGV-------GENAVKIGGEEVLH--RHELTFFNPTGFFYDVWDTMDD---KALEERCDRVVSyk----kfYVGNFL 136 Archaeoglobus fulgidu...
O29870 128 EVVLGAtkadggtREYTVTLGGERSLafytFDAPQPHLPAIAIDVFD-RRPMLAKAVRMHYEDVLDNpaewarkCVKK-F 205 Archaeoglobus fulgidu...
O27747  74 QVKLGEg------TRKSVYLGGQKALY--RFEEPQPNPPVVTFDVFDIPMPGLPRPIREHFSDVMEDpgdwarkAVKE-Y 144 Methanothermobacter t...
Q57577  89 EVQFGKpks-eggRGKVVKIGGQRALY--RFEEPQPNPPVVTFDIFDIPMPGLPKPIRQFFQDVMEDpcewakkCVKE-F 164 Methanocaldococcus ja...
Q50538 113 EVPIGNtsadggsRGKRVLVGGEKALpf-yFDAPMPNRNQVTIDVFDMRI-GLAKAVKENYDEVMDSpgewakkNVEK-F 189 Methanosarcina thermo...
4DJF_E 127 TIQAIAIRHDADDp-------AAFKAAVASVAAATQLNLVLMAD-----DPDVLKEALAGVAdRKPLLYAATGA-NYEAM 193 Moorella thermoacetica
Q57576 133 KLDFIVIRNASGDv-------EKFKKAIEIVEKETKMPICIASL-----NPEVIKEALKVVK-SKPMVYAATKE-TLNDF 198 Methanocaldococcus ja...
O27748 127 TLDAIALRNRSGSp-------EKFAEAAEAISK-LNFPVVLCTF-----DVEAMKAALEVLGdQKPLLYAARED-NLGEM 192 Methanothermobacter t...
Q50539 133 LLDGVAIKATSNDp-------AKFAAAVKKVAE-IGLPMIFCSF-----NPAVLKAGLEVAKdKNPLLYAANKD-NWKEV 198 Methanosarcina thermo...
O29871 137 TLDGFAVRCTSGDp-------KRYREVVKKVA-SYGKPLILVAL-----DSECMKAALEEVAdQRPLMYAATEG-NWKEF 202 Archaeoglobus fulgidu...
O29870 206 GADLVTLHLISTDpllddtpaSEAVKVLEDVLQAVKCPIIVGGSgnkekDPEVLEKAAEVAEgERIMLASATLDmDWERI 285 Archaeoglobus fulgidu...
O27747 145 GANMVTIHLIGTGpkvmdkspREAAKDIEEVLQAVDVPLVIGGSgdpekDPLVLEKAAEAAEgERCLLASANLDlDYRKV 224 Methanothermobacter t...
Q57577 165 GADMITIHHISTDpkikdkspKEAAKLMEDLLQAVDVPFVIGGSgnpqkDPLVLEACAEVAEgDRCLLASANLElDYKKI 244 Methanocaldococcus ja...
Q50538 190 NADMITIHLISTDplikdtpaKEAAKTVEEVLQAVDVPIAIGGSgnpqkDPEVLAKAAEVAEgERCLLASASLNlDYAAI 269 Methanosarcina thermo...
4DJF_E 194 TALAKENNCPLAV-YG-NGLEELAELVDKIVA-LGH--KQLVLDPGArET-----SRAIADFTQIRRLAIKKrFRSFGYP 263 Moorella thermoacetica
Q57576 199 IKVIKEVKKDVVLvLSsNNVKDLKNMAAKCLA-NGI--EDLVLEPHT-YPen--iAETLDLNVMIRRSAIEKeDKYLGFP 272 Methanocaldococcus ja...
O27748 193 AELSVSYGCPLVL-FSpGDLEEMKNLSRRLRS-LGV--TEIVLDPGT-FTge-giGDTIDNFVMIRRLAVEDgDDDFRFP 266 Methanothermobacter t...
Q50539 199 GELALEYKVPVVV-SVfNDLDGLKSLAKTFAE-AGI--KDIVLDPGT-YPsgkglKDTFTNFLKIRRAGIMG-DTEIAYP 272 Methanosarcina thermo...
O29871 203 LKLALEYKVPVTL-RA-KDLDLLKSMAVTFKQ-AGV--KDIVLDPVT-EPlgeglKGTFERVIQLRRTAIAGqDKDVAYP 276 Archaeoglobus fulgidu...
O29870 286 ANAAKKYGHVVLS-WTqMDINNQKTLNRYLLKrVEMprDSIVMDPTT-AAlgyglDYAFTNMERIRISGLKG-DTDLNFP 362 Archaeoglobus fulgidu...
O27747 225 ARAALDHNHAVLS-WAiTDVNMQKTLNRYLLKe-GLkrEDIVMDPTT-CAlgygiEFSIDVITRTRLAALKG-DSDLQMP 300 Methanothermobacter t...
Q57577 245 VDAAMKYDHNVLA-WSiMDPNMARDLNRKLVE-AGLdpNRIVMDPTT-CAlgygiEFSINAMVRLRLNGLKG-DELVNMP 320 Methanocaldococcus ja...
Q50538 270 AEAALKYDHDVLS-WTqLDMNAQKELNRKLMKqCNVprDRIIMDPTT-AAlgyglDYAYTNMERIRLAALMG-DDELTFP 346 Methanosarcina thermo...
4DJF_E 264 IIALTTAANPLDEv----------LQAVN-----------YVTKYASLVVLRTDAKEHLLPLLSWRQNLYTDPQVPIRVE 322 Moorella thermoacetica
Q57576 273 ILNLPINAYYYALknecpisgffeDKEVVakmfeatiantLMNRYADALIMHGMDIWELMPVLTLRQCIYTDPRKPQAVE 352 Methanocaldococcus ja...
O27748 267 IMGIPALSRLTv------------SDKIEanireatvaatLMNRYADILILAGTEIWEIMPVLTLRQGLYTDPRKPQAVD 334 Methanothermobacter t...
Q50539 273 IMALPLTAWMAGi-----------SDPVSasywetviasvFTIRYGDIMILHSLEPYAALPEMHLAETIYTDPRTPVSVD 341 Methanosarcina thermo...
O29871 277 IMITPIAAWLIE------------GDDVTksyweaviasiFIVKYGDVMIFRSIDQHVVMPTITLRFNIYTDPRTPVQVE 344 Archaeoglobus fulgidu...
O29870 363 ISSGTTNAWGARE-----------AWMVD---------------------------------------------SPIEED 386 Archaeoglobus fulgidu...
O27747 301 MSSGTTNAWGSRE-----------AWM---------------------------------------------------KK 318 Methanothermobacter t...
Q57577 321 MSSGTTNAIGARE-----------AWM---------------------------------------------------NN 338 Methanocaldococcus ja...
Q50538 347 MSSGTTNAWGARE-----------SWMVG---------------------------------------------SPLSQD 370 Methanosarcina thermo...
4DJF_E 323 EKLNEIGAVNENSPVYVTTNFSLTYYSVEGEIESTKIPSYLLSVDTDGLSVLTAYADGKFEAEKIAAVMKKVDLDNK--V 400 Moorella thermoacetica
Q57576 353 PGLYPIGNPDENSPVILTTNFSLTFYTVTGDFEKDNVTCWLLVMDTGGKAVDVSVAGGQYNGENAKKLIEETGIADK--V 430 Methanocaldococcus ja...
O27748 335 PGVYEFGDVDENSPVILTTNFSLTYYTVEGDLKSGDVTAYLLVLDTEGRAVDVSLAGGQLNGPAVADLIKETGIEER--V 412 Methanothermobacter t...
Q50539 342 GGMYKVGEPDKDSPVFFTTNFALTYYTVESDISANGIVCWLLAVDTDGIGVEAAVAGGQLTSAKVKDAFEKAGFDLKtdT 421 Methanosarcina thermo...
O29871 345 PGLRAINDPGPDDPVFITTNFALTYYTVESDLTSGGIKGWLLVLNTEGLGVEVSVAGGQFTASKVKELIEETKIEEK--V 422 Archaeoglobus fulgidu...
O29870 387 TPW---GPRELRGPIWEIIT-----------------------------GLTLSLAGVDL-------------------- 414 Archaeoglobus fulgidu...
O27747 319 DEW---GPTDYRGPLWEIVT-----------------------------GLTMMLSGVDI-------------------- 346 Methanothermobacter t...
Q57577 339 PEW---GPREYRLPLWEITT-----------------------------GITMMMCGVDL-------------------- 366 Methanocaldococcus ja...
Q50538 371 TDW---GPREYRGPIWEIVT-----------------------------GLSLAIAGNDL-------------------- 398 Methanosarcina thermo...
4DJF_E 401 KRHRIII-PGAVAVLKGKLEDLTGWEVIVGPREASGIVAFA 440 Moorella thermoacetica
Q57576 431 SHRIIIL-PALAASTRGDIEDKTGWTCVVGTRDSSQVGDFL 470 Methanocaldococcus jannaschii DSM 2661
O27748 413 RDKVMII-PGLAAPASGEIEDDTGWRVLVGPRDSSGIPDYL 452 Methanothermobacter thermautotrophicus str. Delta H
Q50539 422 NHNTLII-PGLSARLQGDLEDTLGANVKVGPMDSGRIPGWV 461 Methanosarcina thermophila
O29871 423 NHRYLVI-PGLAARLQGAIEDETGWKVLVGPMDSGRIKGWL 462 Archaeoglobus fulgidus DSM 4304
O29870 415 ---FMMMhPVAVAVLKEVFNTL-GGKVSGGVADPGEWIFME 451 Archaeoglobus fulgidus DSM 4304
O27747 347 ---FMMLhPTSVRLLREIGETFTREYMTAETPDLREWITEL 384 Methanothermobacter thermautotrophicus str. Delta H
Q57577 367 ---FMMLnPISVKTLKEIGKTLTTKPGEVKLNTNNYEWIVS 404 Methanocaldococcus jannaschii DSM 2661
Q50538 399 ---FMMMhPTSVAVLKQITQTLFGSIEAEPVDITNWIGAEV 436 Methanosarcina thermophila
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap