1RU3


Conserved Protein Domain Family
CdhC

?
pfam03598: CdhC 
CO dehydrogenase/acetyl-CoA synthase complex beta subunit
Statistics
?
PSSM-Id: 397587
Aligned: 63 rows
Threshold Bit Score: 226.24
Threshold Setting Gi: 150014297
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1RU3_A            323 LPINFGPAFEGESIRKGDMHVEFGG-GkTPSFELVRMVGPDEIEDGKVEVIGPDIDSVEPGGRLPIGIVVDIYGRKMQED 401
Q57620              5 IPVSVGPMNEGERVRGPDMYVELAGpK-SYGFELVKV--VNKAED-KVEIIGKDIDEMEEGSRNPFAIIVEVSGSNLEED 80  Methanocal...
jgi:Maeo_1171     296 IPVSVGPMNEGERVRGPDMFVELAGpK-QYGFELVKV--VDDASD-KIEIIGKDIGEMEAGTKTPFAVIINVSGKTLEDD 371 Methanococ...
Q8TXF4              7 LPVDVSPRHEGERIRSGDMYVELAGpK-SFGAELFKVVDPDEIEPDKVEVIGPDIDEMEEGGRYPFAIYVKAAGEELEED 85  Methanopyr...
Q6LYK8              5 IPVEISPMYEGERIRAANMFVELAGpK-SVGAELVLV--SDDVEDGKIEVIGPELKDMEEGKKYPFGILMEVSGEKLEKD 81  Methanococ...
CDG65655            5 IPVDVSPMYEGERIRSANMFVELAGpK-SMGAELVQV--EENVEDGKIEVIGPELDAMQEGDIHPLGILIEIQGEHLEKE 81  Methanobac...
O27745              5 IPVDVSPMHEGERIRSANMFVELAGpK-SIGAELVQV--KDEVEDGKVEVKGPEIDEMEQGQVYPFAINVEVAGSELEEE 81  Methanothe...
jgi:Ferp_0733      25 FPFEISPMFEGERVRKGDMYVELGGpS-QPGFELVIALPKDQVEDMKVTLIGPDLDEMEEGKAYPYAMIYYVAGDQVDND 103 Ferroglobu...
WP_013037615        5 FPFEISPMFEGERIRKNDMYVELSGpK-SIGFELVKAAEMDDVVDGKFNMIGPDVQDMEEGGRYPFAMIYKIAGELVEED 83  Methanohal...
HusnBIG:Mpsy_2893   5 FPFEISPMFEGERIRKEGMHVELAGpK-SKGFELVRAADMNDVEDGRFTLIGPDLSDMEEGSRYPFAMIYKIAGELVETD 83  Methanolob...
1RU3_A            402 FEPVLERRIHYFTNYGEGFWHTAQRDLTWVRISKEAFAKGA-RLKHLGQLLYAKFKQEFPSIVDRVQVTIYTDEQKV 477
Q57620             81 LEGVLERRIHEFLNYIEGVMHLNQRDQVWIRINKDSFNKGL-RLKHIGKVVQRLFKAEF-PFIEKCDVTIITDPEKV 155 Methanocaldoc...
jgi:Maeo_1171     372 LEGVLERRVHEIFNYIEGVMHLNQRDSVWIRINKESAEKGL-NLIHIGKIIQDIYKSEF-PFIENIDVKLITDADIV 446 Methanococcus...
Q8TXF4             86 VEGVLERRIHEFCNYVEGFMHLNQRDQIWCRVSKNVTEKGF-RLEHLGIALRELYKEEFGNVIDSVEVTIMTDEEKV 161 Methanopyrus ...
Q6LYK8             82 LEGVIERRIHEICNYVQGFMHLNQRDKIWCRIGKDSHAKGF-ELKHLGQALSTLFKDEF-PIIEAISITIFTEEEKV 156 Methanococcus...
CDG65655           82 LEGVIERRTHELCNYVKGFMHLNQRDAIWCRVSKEAMEAGF-KLEHLAKTLAVLFKEEF-PLIESIAVTILTEPAKV 156 Methanobacter...
O27745             82 LESVIERRLHELCNYVKGFMHLNQRDQIWCRVSTEAKDAGF-RLEHLGKALSVLFREEF-PIIESIAVTLMTDEAAV 156 Methanothermo...
jgi:Ferp_0733     104 LEPVIERRNHDFQNYIEGYMHLNQRYDIWIRISKGAIKKGLkSLTEIALATMFLFKNEL-PFIEKIEAVYITDKELV 179 Ferroglobus p...
WP_013037615       84 LESIVERRNHDFQNYIQGLMHLNQRYDVWVRLSKEAVEKGVtSFESIAQAIMMLFKNEL-PFIEKVEATYITDKDEI 159 Methanohaloph...
HusnBIG:Mpsy_2893  84 LESIVERRNHEFQNYIQGMMHLNQRDDVWIRVGKEAVSKGLnSFEHIAKAVMMLFKNEL-PFIEKVEAIYITDMDEI 159 Methanolobus ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap