Conserved Protein Domain Family
BenE

?
pfam03594: BenE 
Benzoate membrane transport protein
Statistics
?
PSSM-Id: 397584
Aligned: 8 rows
Threshold Bit Score: 385.188
Threshold Setting Gi: 81552054
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9RY94                 39 QdTHPSAVLAG-LIAVVIGWAGPNVLIYSVQ---QAGHLSDAAAMSWLWGHAVITGIVGIYLSLRTRMPILSTWSTPGIA 114 Deinoc...
P76103                  5 S-IPPPTLLAG-FLAVLIGYASSAAIIWQAA---IVAGATTAQISGWMTALGLAMGVSTLTLTLWYRVPVLTAWSTPGAA 79  Escher...
Q9I374                 15 AdSSPAAVVAG-FVAMLTGYTSSLVLMFQAG---QNAGLSSAQISSWIWALSIGMGLATIGLTLRYRVPIVIAWSTPGAA 90  Pseudo...
Q88I34                 30 kdCSVSAIVAG-SIATTISYAGPLVIIFHAA---EAAGLSHQQLSSWVWAVSMGSALLGALLSLRYRVPVVIAWSIPGSA 105 Pseudo...
P07775                 10 QdWSLSATIAG-FLAVLISYSGPLIIFFQAA---QKAHVSTEMMISWIWAISIGAAVTGIFLSIRFKTPVVTAWSAPGTA 85  Acinet...
calssnu:BYI23_D002100  12 gdWSVSAVSAG-LLAVIISYAGPLAIFFQAA---HAAHVGNEVVASWVWSISMGAALSGIVLSAWLKQPVITAWSAPGKA 87  Burkho...
Q9RUP7                156 ApAQPCTVGGGrVPAPYFPRAARRGLSDWGAggfAAAHSSPAQGASALASMYLLLGVMGMTLCWRYRVPVVLGWNTPGLA 235 Deinoc...
Q9KQM8                  4 GfFNLSHLSAG-FTTVLVGYTSSVVIVIQAA---TASGANPTQIESWLLTLGVVMGLTSILYSWFYKTPIVTAWSTPAAV 79  Vibrio...
Q9RY94                115 LLVTALPGMPFAEAVGAFLVSAALVFLLGTFAPLTRAVQAIPTHLAAALNAAILLPFAFKAVQAFGTQPLLVGLMVVTYF 194 Deinoc...
P76103                 80 LLVTGLQGLTLNEAIGVFIVTNALIVLCGITGLFARLMRIIPHSLAAAMLAGILLRFGLQAFASLDGQFTLCGSMLLVWL 159 Escher...
Q9I374                 91 LLISSLPGVPYSEAIGAFIVCALLITLCGVTGSFERLMRQVPSSLASALLAGVLFRIGIEICNAAEQQTLLVLAMFFSYL 170 Pseudo...
Q88I34                106 LLVTALPQLGLEQAVGAYLVANLVLLLIGISGAFDRIIARLPGSIAAGMQAGILFSFGIEVFRALPVQPLLVLAMFVTYV 185 Pseudo...
P07775                 86 LLVTLFPNISLNEAVAAYITAAIVIFLVGITGYFDKLLKWIPQGIAAGMMAGILFQFGLGLFLATDTLPLIVFSMLLCYL 165 Acinet...
calssnu:BYI23_D002100  88 LLVTLFPGMPVSEAIGAYIVAGACIFALGVSGFFDQIVKRIPKGIACAMMAGILFQFGVNVFKSVAVTPALALGMLASFI 167 Burkho...
Q9RUP7                236 VLIASAGRFTAAEVVGALLVSGAVLALVGLSRAFDWLARTLPLPLALALLAGVLLPFVLRGLAAIPQAPALTLPTLLAYL 315 Deinoc...
Q9KQM8                 80 MLAASAGQYSLPVVIGAFMFSGALFTLTGMLAPLTRALSKIPVPLGTAMLGAILLPFCAKAFTPLTDTPALFALLFTSYL 159 Vibrio...
Q9RY94                195 LGRQFAPRWAVALVLLVGVAASALLGAWHPAPVPL--APTVPQVVAPAFSVRAMLNLALPLTLLAFTGQFVPGFGVLKAN 272 Deinoc...
P76103                160 ATKAVAPRYAVIAAMIIGIVIVIAQGDVVTTDVVF--KPVLPTYITPDFSFAHSLSVALPLFLVTMASQNAPGIAAMKAA 237 Escher...
Q9I374                171 LCKRFSPRYAVFAALLVGVLLAGILGQLDFSRFRL--ELAVPEWTTPSFSLAATISIGIPLFIVAMASQNMPGIAVLRAD 248 Pseudo...
Q88I34                186 LMRRVQPRYAVAAVLGVGMLVTVASGTLRSEALVL--ELASPQWITPQFSLSAVFSLALPMVLVALTGQFMPGMAVLRNA 263 Pseudo...
P07775                166 ISRRFSPRYCMLWVLICGVAFSFFLGKMNPVPLDF--QIARPQFIAPEWSWFSTLNLALPLILVSLTGQFLPGMAILKLS 243 Acinet...
calssnu:BYI23_D002100 168 VFRRFAPRYCLILVLAFGGVLAVALGLTHFEAVSL--HITRPVFTMPTWSWQSTVSLAVPLVIVSLTGQFLPGFAILRAS 245 Burkho...
Q9RUP7                316 LARVFAPRWAVPLALVTGVTVAALTGQLHLSALGHtsLLARPEWITPTFSSQALLTLALPCTILALTSQHLAGMAVLHTH 395 Deinoc...
Q9KQM8                160 LAKHLVPRYTMLVLLLVSLGSALALGSFQHADLAL--RIATPIWVMPEFDWLAILNLALPLYLITMLSQNLPGIAMLKSY 237 Vibrio...
Q9RY94                273 GY-EPAPGPILRACGVASAAAALVGCHNLTLGALLANIVSGPEAHPDAARRYTAAIWAGIFNILFGLFAGTFLHLMGILP 351 Deinoc...
P76103                238 GY-SAPVSPLIVFTGLLALVFSPFGVYSVGIAAITAAICQSPEAHPDKDQRWLAAAVAGIFYLLAGLFGSAITGMMAALP 316 Escher...
Q9I374                249 GY-QVPASPLISSTGIASILLAPFGSHGINLAAISAAICTGPSAHEDPHKRYTAALWCGFFNCVAGTFGATLAALFAAFP 327 Pseudo...
Q88I34                264 GY-PTPASPLISASALIGVLLAPFGCHGLNLAAVTASLCTGHEAHENPQRRYVAAVAGSVLYLLLGIAGATLMSLFAAFP 342 Pseudo...
P07775                244 GY-NTPAKPIIAAASLASLFAAFAGGITIVLASITATLCMGKDAHELKDKRYIAGIANGLFYVLGGVFAGSIVALFSLLP 322 Acinet...
calssnu:BYI23_D002100 246 GY-ETPTRPVLMTTSLTSMLVAFSGGITIVIAAITAALCTGPDAHRDPRRRYVAGIANGLFYLIGGCFAGTVVMLFAALP 324 Burkho...
Q9RUP7                396 GYrQVPPALLVTVTGAASALAAPLGSVTMNMGAITAAICMGPDVHPDPNRHYVAGLACAGGYLVLGLCAGALLGLAGSFP 475 Deinoc...
Q9KQM8                238 QY-DAPIKPILVGTGLATLMSAPFGGFSVNLAAISAAICMNEDVDQDKAQRYRAVLWAGGFYLLAGIFAALVVNLFLALP 316 Vibrio...
Q9RY94                352 AEALAALAGLALLAATGGSLQAAFTPGQSASgrgaaqpgslAAAVIIAVTLSGVSFFGIGAAFWGILAGLAVHGL 426 Deinococcus...
P76103                317 VSWIQMLAGLALLSTIGGSLYQALHNERERD----------AAVVAFLVTASGLTLVGIGSAFWGLIAGGVCYVV 381 Escherichia...
Q9I374                328 KALVLSIAAIALLGSIMNGLANSMADERQRE----------AALVTFMVTASGFTLLSIGSAFWGLVAGLLTQFV 392 Pseudomonas...
Q88I34                343 AVLIAALAGLALYGAISEALVRSLAEPAERD----------AGLFTFLVTASGVAFLGLSAAFWGLLFGllahal 407 Pseudomonas...
P07775                323 KELVAALAGLALLGAIASNIKIAMQEDQQRD----------PALITFLATVSGMHFLGLSSVFWGMCIGMLAYFI 387 Acinetobact...
calssnu:BYI23_D002100 325 NAFVAVLAGLALLGAIAANIVGLVQDEAHRE----------ASFITFIATASNMSFLGLGSAFWGIVLGTLAHLV 389 Burkholderi...
Q9RUP7                476 APLMQLLAGLALLGSVLSGLQNALSDPRWRE----------GALLAFACTAAGFSFLNIGGALWGLLLGWGSAAL 540 Deinococcus...
Q9KQM8                317 KPISAMLAGLALLGTLMMCLQSAFKIDEYRE----------PALLTFVITLSGATLFGMSATLIGLVIGLAYLRL 381 Vibrio chol...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap