3BBD,3O7B


Conserved Protein Domain Family
EMG1

?
pfam03587: EMG1 
Click on image for an interactive view with Cn3D
EMG1/NEP1 methyltransferase
Members of this family are essential for 40S ribosomal biogenesis. The structure of EMG1 has revealed that it is a novel member of the superfamily of alpha/beta knot fold methyltransferases.
Statistics
?
PSSM-Id: 397578
Aligned: 119 rows
Threshold Bit Score: 154.241
Threshold Setting Gi: 74777018
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3BBD_B             5 IILAKSALELIPEeiknki-------rksrvYKYDILDSNYH----------------------YKAx--EK---LKDKE 50  Methanocald...
XP_001617343     256 IFLLFCPLAVTSIr-----------------NRRCVINADEHmsflqnklksvesllacarnakESAflrSKaeaVENKL 318 malaria par...
Q8I5G2           208 IVLLFSPLALTSIkn---------------kQKTCIINADDHmnmfmnklenlenaikfekkekEKRkleQIiqsVKNKL 272 Plasmodium ...
EQB72294           5 VVI-DAELETVPDimkddysiriqakkrgklASKMLLDSNFM----------------------HSAierYF---PGESN 58  Thermoplasm...
Q6L170             4 IVIGDAELETIPDemrndpvlrrmanknkkdINYMLLDSNYM----------------------HSIierYY---PGKSN 58  Picrophilus...
jgi:Vdis_1824      6 lLLTEASLETIPKellsdpviirdakrrgvnPRYLILDRARH----------------------HRAm--TR---LPNAE 58  Vulcanisaet...
Q8ZW45             3 LVLAESALELVPKeiwnhpavladarrrgkrPGEILLDRARH----------------------HPAm--RL---LADAK 55  Pyrobaculum...
CCC82355          27 LILAESSLELIPPeiqshplilrdarrrgkePRSILLDKARH----------------------YKAm--RG---LPKSE 79  Thermoprote...
CBRAS:FFONT_1267  25 V---ESSLEPLPKelvnskkavilsrrfniePKYLILDKSLF----------------------YEEm--KV---LKEKE 74  Fervidicocc...
jgi:Cmaq_0625      7 lILVDAALEPIPPelrndkgivktarrlgrdPIYMPLDKALH----------------------FKAm--SK---LKGKE 59  Caldivirga ...
3BBD_B            51 XRGRPDIIHISLLNILDSPINHEKKLNIYIHTYDDKVLKINPETRLPRNYFRFLGVXEKVLKGER------NHLIKXEE- 123 Methanocald...
XP_001617343     319 KNVRLDVLFFTLLCLRDSVINKRGRLQIYLHTVNGLLIYVSPSFRVPRSFSLFKKVMLNLMLRNVvldpggRPLLKVLP- 397 malaria par...
Q8I5G2           273 ENIRLDILFFTLLSLRDSILNKKGKLQIYIYTVNGSFIFVSPLFRVPRNFTLFKKVMLNLLKRGVvyddqkNVLLKIIF- 351 Plasmodium ...
EQB72294          59 RRGRPDIIFHLLMTSLESILNKKSGLRVIIHTRNNQIIEINPSIRLPKSYNRFVGLMEDLFDKRAigpqseT-LMKVTD- 136 Thermoplasm...
Q6L170            59 RFGRPDIIYIFLEVALESILNKSGNLRIFIHTKRNKVIEINPEVRLPKSYNRFQGLIEDLFRKNRivyngnT-LLDMYD- 136 Picrophilus...
jgi:Vdis_1824     59 KRGRPDILHQALLLIQGSLLARNNLVKTYVHTVNDLVIDVDPEIRPPRNYDNFIGLMSQLFEVGRvpp-vgkPLMRFVN- 136 Vulcanisaet...
Q8ZW45            56 RRGRPDIVHQVLLAFQYSLLAKRGLGKAYIHTRDDYVIAVSPEARVPKNYNNFVALIEQLFALGKvpp-kgePLMELYR- 133 Pyrobaculum...
CCC82355          80 KRGRPDIVHMSMLAFQYSVLNMKGMGRMFVHTINDVVIRLRSDARIPKNYWNFVGLMEQLLNAGAvpp-wgePLLIAER- 157 Thermoprote...
CBRAS:FFONT_1267  75 KRGRPDIIHQFLLATQYSYLNLKGKLKVFIHTINNDIIEVNPITRIPKNYFQFVSLIQNLYKYKKvprsgeA-LLILRKn 153 Fervidicocc...
jgi:Cmaq_0625     60 SRGRPDIVHKFLLDSLNSLLAKRGMLTVYIHTVTGRVIEVAPGERPPQNYFNFLGLMEQLFKHGSvppsgkW-LLRFMD- 137 Caldivirga ...
3BBD_B           124 KTLEDLLNEinAKKIAIXTKT-GKlthpkl-------lkeydtFIIGGFPYGKLKI----Nkekvf---gdikEISIY-N 187 Methanocald...
XP_001617343     398 HPVQRYVGS---SVCIGISHM-GFpadvkklskqiketkndysFFLSLSSAYDLTHfiesIsrthsecfpfdyVVRVS-D 472 malaria par...
Q8I5G2           352 NDITSYVED---AVCIAISNK-GFptdvkkltdkikqtknnyfFFISLSNSHDVTKfmdiIkkektktfsydyLVRLS-D 426 Plasmodium ...
EQB72294         137 GNWKDALNMt-EGNQILLSPR-GIpgkiadvf----hgagdqsVIIGGFSQGDFIS----Dvys------lgsGISIY-P 199 Thermoplasm...
Q6L170           137 MDLLSLLSR--FNNVIVLSPH-GEknrlnni------isddvcFLIGGFSEGDYIT----Dvyk------kykSYSIF-N 196 Picrophilus...
jgi:Vdis_1824    137 -GINYVLNTesPDRKILLDDVkGKevslksfid-yvknfkrplIMIGAFPRGSFEE----Rtygl-----addVLKIG-K 204 Vulcanisaet...
Q8ZW45           134 KDLATLLQEl-GGVWAVFHES-GArkplsqmg----sellksvVVVGGFPHGDFQN----Kwvve----kaavVYSLG-E 198 Pyrobaculum...
CCC82355         158 KSLRELLREl-GGRWIVLHEE-GNrvdplelg----ralansvVVVGGFPHGDFED----Krilr----dassVFRIS-D 222 Thermoprote...
CBRAS:FFONT_1267 154 VKLSEYLKEknIEKPILLHEK-AEkveynele---kfyfppcsFLIGGFPHGDFSK----Dtkmv-----awrSISLKkD 220 Fervidicocc...
jgi:Cmaq_0625    138 VSISELVESmnESLIILLERD-GEpikvtelar-liiknggavVMIGGMPKGssevar----------alarrVFSLAnG 205 Caldivirga ...
3BBD_B           188 KGLXAWTVCGIICYSL 203 Methanocaldococcus jannaschii
XP_001617343     473 LPLSTVAVCSKL-THF 487 malaria parasite P. vivax
Q8I5G2           427 LQLSAVALTSKL-THF 441 Plasmodium falciparum 3D7
EQB72294         200 GELSIWSVAMECICQY 215 Thermoplasmatales archaeon A-plasma
Q6L170           197 EELTIWSVGMEVITEY 212 Picrophilus torridus
jgi:Vdis_1824    205 YIMDTSSILCRLLTAL 220 Vulcanisaeta distributa DSM 14429
Q8ZW45           199 ESLDAAQVICKAVTAA 214 Pyrobaculum aerophilum str. IM2
CCC82355         223 MPLDAWQVVFRAVTLA 238 Thermoproteus tenax Kra 1
CBRAS:FFONT_1267 221 FIMDAWMVADRIICHL 236 Fervidicoccus fontis Kam940
jgi:Cmaq_0625    206 ESLTTSHVVNSLIISI 221 Caldivirga maquilingensis IC-167
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap