6ODM


Conserved Protein Domain Family
Herpes_UL36

?
pfam03586: Herpes_UL36 
Herpesvirus UL36 tegument protein
The UL36 open reading frame (ORF) encodes the largest herpes simplex virus type 1 (HSV-1) protein, a 270-kDa polypeptide designated VP1/2, which is also a component of the virion tegument. A null mutation in the UL36 gene of herpes simplex virus type 1 results in accumulation of unenveloped DNA-filled capsids in the cytoplasm of infected cells. This family only covers a small central part of this large protein.
Statistics
?
PSSM-Id: 397577
Aligned: 5 rows
Threshold Bit Score: 323.734
Threshold Setting Gi: 81987375
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6ODM_B 1326 HERWAADVEAVLDRVESGAEFDVVELRRLQALAGT-HGYNPR--DFRKRAEQALGTNAKAVTLALETALAFNPYTPENQR 1402
P09278 1255 YERWTRDIIACLEAMETRHIFNGTELARLRDMAAA-GGFDIH--AVYPQARQVVAACETTAVTALDTVFRHNPYTPENTN 1331 Human herpesvirus 3...
Q9E6N3 1399 EDLWISSINSLLLNAEVKSEFDAMEINRLEDAART-GGYDTI--RYKSRAEKIVIAHARVLESSIESVLKFNPYSTQNMV 1475 Marek's disease her...
Q6UDJ5 1180 KHAWRSRLRTLLERDRDDGEFSLDAWDQARDEGECyGGRDAVndDLIKLARAVIDGRIQLGLRLVRAFFANNPYAAQASQ 1259 Psittacid herpesvir...
P10220 1356 HERWAADVEAVLDRVESGAEFDVVELRRLQALAGT-HGYNPR--DFRKRAEQALGTNAKAVTLALETALAFNPYTPENQR 1432 Human alphaherpesvi...
6ODM_B 1403 hpMLP-----PLAAIHRI---DWSAAFGAAADTYADMF-RVDTEPLARLLRLAGGLLERAQA---NDGFIDYHEAVLHLS 1470
P09278 1332 --IPP-----PLALLRGL---TWFDDFSITAPVFTVMFpGVSIEGLLLLMRIRAVVLLSADTs--INGIPNYRDMILRTS 1399 Human herpesvirus 3...
Q9E6N3 1476 hgLSP-----PIAALKSI---TWGDSFMTAAPYYTKLF-GVNCDTVMDLLHISIAILRHANA---NSGNVDYYLLMGELE 1543 Marek's disease her...
Q6UDJ5 1260 --ALPgdargPVELLESIrvaKWIFAFPGVADTYEYLF-GISVVKLKALCEIGEEIVEAFDAagsSDKNIDMHAFVQTVA 1336 Psittacid herpesvir...
P10220 1433 hpMLP-----PLAAIHRI---DWSAAFGAAADTYADMF-RVDTEPLARLLRLAGGLLERAQA---NDGFIDYHEAVLHLS 1500 Human alphaherpesvi...
6ODM_B 1471 EDLGGVPALRQYVPFFQKGYAEYVDIRDRLDALRADARRAIGSVALDLAAAAEEISAVRnDPAAAAELVRAGVTLPCPSE 1550
P09278 1400 GDLLQIPALAGYVDFYTRSYDQFITESVTLSELRADIRQAAGAKLTEANKALEEVTHVR-AHETAKLALKEGVFITLPSE 1478 Human herpesvirus 3...
Q9E6N3 1544 SALKSYPNLVKYVNFYRSGYVKFMSFLAHLEQRRVEAHHASGRVALEISAALEDLARTH-SPEGARRALEYGVSIIIPSV 1622 Marek's disease her...
Q6UDJ5 1337 GKLFQVSELTEFFDFYVRSYELFLDIRAALAETAGRV-GALERTALEQLGAEERAAESIrDPEAAKERLERGDR----DP 1411 Psittacid herpesvir...
P10220 1501 EDLGGVPALRQYVPFFQKGYAEYVDIRDRLDALRADARRAIGSVALDLAAAAEEISAVRnDPAAAAELVRAGVTLPCPSE 1580 Human alphaherpesvi...
6ODM_B 1551 DALVACVA---ALERVDQSPVKDTAYAD 1575
P09278 1479 GLLIRAIE---YFTTFDHKRFIGTAYER 1503 Human herpesvirus 3 strain Dumas
Q9E6N3 1623 NTIMSIAE---ELKKDHVEELEGTAYSE 1647 Marek's disease herpesvirus type 1 strain MD5
Q6UDJ5 1412 DALTAMRElhgGLKLESKKQFEKTAYLE 1439 Psittacid herpesvirus 1 Amazon parrot/1997
P10220 1581 DALVACVA---ALERVDQSPVKDTAYAH 1605 Human alphaherpesvirus 1 strain 17
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap