4J7G


Conserved Protein Domain Family
Hexose_dehydrat

?
pfam03559: Hexose_dehydrat 
NDP-hexose 2,3-dehydratase
This family includes a range of proteins from antibiotic production pathways. The family includes gra-ORF27 product that probably functions at an early step, most likely as a dTDP-4-keto-6- deoxyglucose-2,3-dehydratase. Its homologs include dnmT from the daunorubicin biosynthetic gene cluster in S. peucetius, a similar gene from the daunomycin biosynthetic cluster in Streptomyces sp. strain C5, eryBVI from the erythromycin cluster in S. erythraea and snoH from the nogalamycin cluster in S. nogalater. The proteins in this family are composed of two copies of a 200 amino acid long unit that may be a structural domain.
Statistics
?
PSSM-Id: 397563
Aligned: 70 rows
Threshold Bit Score: 190.061
Threshold Setting Gi: 122316704
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4J7G_A          38 TEDVRAWIAERRDANVFHVERIPFADLDQWWFEGvtGnLVHRSGRFFTIEGLHViehdgPHGDGPYrewQQPVIRQPEVG 117
WP_014982317   249 DAELQSWFTVERARRDVEISLMPLADVEGWHRGE--ThIGRADDRFFRLIAVEV-----EAGSREVtswTQPLFEPHGQG 321 Nocardia bras...
jgi:Strop_2181 248 DADVASWFTGQRASHEVRAHRIPLAQVAGWCRDE--HrIYRPDQRYFRVLAVAV-----EGANREVsswSQPLIEPVAPG 320 Salinispora t...
WP_020939990   274 DVDLLSWFTSERSRYDVRAERIPLAEVPGWTRDE--ArIGKDDGRWFDVVAVEV-----QAGNREVtswTQPLIEPSSRG 346 Streptomyces ...
WP_015103260   265 ASEILSWFTEAKTGCDWSARLAPLDAVPGWSRDD--ReIGDDAGEDFRIIGVSV-----EAGTREVkswTQPLLFPRGQG 337 Saccharothrix...
WP_014911243   260 lAGIVGLLTDVKVACTRDRRLVPLTEVEGWSITD--EeIVDDARREFRVMAVDV-----RAEGREVgrwTQPLLEPHDVH 332 Nocardiopsis ...
WP_013155701   256 MTGVVSWFTEAKTVVDWRSELLPLPRAEGWRRTG--DeI--SGGPGFRIIMVSV-----SARIREVaswTQPLLAPERHG 326 Nocardiopsis ...
CDD66118       260 iSEIYQFLNNYKMFEEKKTVLVPLNQLRDWSVDD--YgVTCSHEADYMVRYYDI-----EINGREVkqwSQPLFKAIGKA 332 Firmicutes ba...
CDD66375       260 iprvYNAINNYKMFHDVMTVETPLNQLTDWVVDE--RgITCKNKADFMVKYYDI-----SIEGREVqhwTQPLFKATGEA 332 Firmicutes ba...
WP_005604069   260 lRNMYQYINDYKMFNDVKRTTIPLFELVDWNVSD--KgVDCTKNANFNVRFYDI-----EISGREVqnwVQPLFKAIGKA 332 Butyrivibrio ...
4J7G_A         118 ILGILAKEFDGVLHFLMQAKMEPGNPNLVQLSPTVQA-TRSNYTKAHGGT--NVKLIEYFAPPDPERVIVDVLQAEQGSW 194
WP_014982317   322 IAAFVFRRIDGLPHLLVQAKVEAGFLDTVELAPTVQC-VPANWDQ-------RPPFLDVVRDAGPDQIRYDVVHSEEGGR 393 Nocardia bras...
jgi:Strop_2181 321 VVGFAYRTFAGVPHVLVHARVEGGFLDTVELAPTVQC-VPANYTQASAAQ--RPPFLDLMLEAPPERVRYAATHSEEGGR 397 Salinispora t...
WP_020939990   347 IAAFLTRSFGGVLHVLANAKVEGGFLDTVELAPTVQA-SPDNFAGIPV----RPPFLDLVLSAAPDRIRYDAVHSEEGGR 421 Streptomyces ...
WP_015103260   338 RAAFLARPIDGVLHLLVQARPEHGLLDMVEMAPTVHLlLGEDLSD-------VPPFVRDALASDGAKVRYDNVLSEEGGR 410 Saccharothrix...
WP_014911243   333 TAVFLTKDIGGVLHVLLATRAEPGLADMVEFGPTVRLrSPEEDPGLPEG------FAEALALDDPERVRRDVVLSEEGGR 406 Nocardiopsis ...
WP_013155701   327 FAAFLVREIGGVLHVLVRARAEPGTLDRVEITPTVQ------YSASAEALgrPEPFAAQAESPPDHRVRYDALLSEEGGR 400 Nocardiopsis ...
CDD66118       333 TFGLITRTVNGKKEFLVAGRPEIGSFDYIELGPSVQW-EPTRKPEDDNVV--DSLFRDKIAHG---KTKYQVILSEEGGR 406 Firmicutes ba...
CDD66375       333 LFVLVVTEVDNMLKFVVSLKSEIGSFDKIELGPSIQH-EHTVTQAEFDVF--ENMCYKKLDNPE--CIWNDVMLSEEGGR 407 Firmicutes ba...
WP_005604069   333 EFSLMYSDDSGVREYLVKAVPEIGTFDKVEIGPTVQL-EPSHRNEDDDPV--ERYYHELLEKKH--KADIDVMLSEEGGR 407 Butyrivibrio ...
4J7G_A         195 FFRKSNRNMIVET-VDDVP--LWDDFCWLTLGQIAELMHEDETINMNSRSVLSCL 246
WP_014982317   394 FLNAESRYMFVEA---DLPleVPRNYCWATPAQLNWLAGHGHYLNVQARTLLSCL 445 Nocardia brasiliensis
jgi:Strop_2181 398 FRNAESRYLVVATdEAATPteAPPGYHWVTPGQLSWLAGHSRYVNVQARTLLAIL 452 Salinispora tropica CNB-440
WP_020939990   422 FLYAENRYLVIEAdESEAPmlPPAGYQWVTVGQLSELVKHGHYVNVQARTLLACL 476 Streptomyces collinus
WP_015103260   411 FFNALTRYQVIEV-GEDVPveVPPNFCWLTVRQLIDLLRHGHYLNIEARSLLACI 464 Saccharothrix espanaensis
WP_014911243   407 FRAARTRYRVIDA-GGILPdrAPEGHCWATVGQLTELVRHGGYLTIEARTLLACL 460 Nocardiopsis alba
WP_013155701   401 FHHAQTRYRIVEA-DPDLPaeVPPDFLWVTVAQLMELVRHGHYLNIEARTLLVCL 454 Nocardiopsis dassonvillei
CDD66118       407 FYHEQNHNYIIEIePQELEe-LPEGYFWIDYGTLNYMIQINNCLNIQLRNLLS-L 459 Firmicutes bacterium CAG:882
CDD66375       408 FYHEQNRNVIMYIdYKELKd-LPDNYFLMDFRSLNYLIQVNNCLNIQLRNLLSLL 461 Firmicutes bacterium CAG:882
WP_005604069   408 FYHEENRNTIFKVnKKDVe--ITDKYFWVNYSTLNMLIQVNNCINIQLRNLLSLL 460 Butyrivibrio crossotus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap