1IWM


Conserved Protein Domain Family
LolB

?
pfam03550: LolB 
Outer membrane lipoprotein LolB
Statistics
?
PSSM-Id: 397560
Aligned: 137 rows
Threshold Bit Score: 69.9083
Threshold Setting Gi: 189421507
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1IWM_A            30 QYQTRGAFAYISDQQKVYARFFWQ-QTGqDRYRLLLTNPLGSTELELNAQPGN-VQLVDNKGQRYTADDAEEMIGKLTGM 107
CAS:Atc_0462      48 EWQASGSASIQTPQGSESFSYRWR-QSP-SHQELSIYDPLGRTVARLTASPDG-AELQTIDGKREKAESLEVLLDDVLHV 124 Acidithioba...
jgi:Glov_2189     49 tlssgVTVALRSGEKNISGRGFMVyRRP-DQMRLIMLSPFGTTVMETRLDGPQlTLAYPASGEAFLGN----------IR 117 Geobacter l...
Q74FZ5            36 tlAATVSLSVKTPDGSTGGNGYLLyRRP-DRFHMVMLTPFGTTALEFFAAGERiTILLPSKGQAYVGT----------FA 104 Geobacter s...
chanu:ambt_11170  43 AWQLRGKIAFRQEKEGASANLLWK-TDD-ADFHFRLTNLLGVTMVDLNVNGDK-AIL-EAGNEVYEDADPEPLIYHTTGM 118 Alteromonas...
WP_007638572      48 RWLIKGRIGFKSPEKKQSANFRWQ-QAQ-QRYQLNMTSIIGTSILKMQGDEQS-VTL-VTDDETYQDSDPSHLVWRVTGW 123 Paraglaciec...
Q15SQ7            61 HWKLKGRMAFKGSDEKFSANVNWQ-QID-DSYHLSLNTMLGINILTMQGDKES-AEL-STDDEQYQDTDASHLIWRITGW 136 Pseudoalter...
IBRC:GU3_06255    31 RWQLAAKLGIITPDERGSLSLFWR-QDS-DDYRLNLTNVVGKRVFDLSRRNGR-IELVDSEGQRHTAGNARDLVYTLTGW 107 Oceanimonas...
C4LBL3            43 HWTISGKLAIITPEKKGSVRIRWQ-QNG-DDYHLNLTSLLGTRVMEMRKTGEQ-IVIIDDKGQEYRGTDAEYLVYRLTGW 119 Tolumonas a...
A0KN00            43 HWQLSGKMAIITAQQKGSARVNWQ-QDG-DDYRLNLTSLIGTHILELSRSKGE-ITLIDNEGNPHQSQDAEALIYQLTGW 119 Aeromonas h...
1IWM_A           108 PIPLNS------LRQWILGLPG-----------------DATDYKLDDQYR-LSEITY-----SqngkNWKVVYGGYDTk 158
CAS:Atc_0462     125 QLPARE------LPLWMLGLTN-----------------GASAVHRDAQGL-PETLSR-----G----AWDIHYLRYAAv 171 Acidithioba...
jgi:Glov_2189    118 ELPAATgqqglaMLQWVLAADIpanapqngvveqinergVKEQITL-KQGLiVEKSLA-----S----GEQVRYRNYAVl 187 Geobacter l...
Q74FZ5           105 DLPAKGglqgwrMMQWVVEGSPlyrpeaagrteeqsddgGVTLATYGPDGL-LERKRS-----A----RGEVIYRNYRSl 174 Geobacter s...
chanu:ambt_11170 119 DIPVEP------LLSWIKGLPL-----------------ADDTFTLTEKGL-LNTLESncsacK----GWQVSYANYGNv 170 Alteromonas...
WP_007638572     124 QIPVEK------LRFWIKGQHQ-----------------KYDKVITSEQGW-ISQLQPgcnncQ----NWIINYDNYKLv 175 Paraglaciec...
Q15SQ7           137 QIPVSQ------FPFWIKGQAQ-----------------PIDKVIYAQSGV-IEQLIPvcdscA----GWLITYQDYHQv 188 Pseudoalter...
IBRC:GU3_06255   108 DLPVEQ------LADWIKGLPG-----------------EADTLSLDENGR-PAQVQS-----H----GWQLSYQGYTQi 154 Oceanimonas...
C4LBL3           120 QMPVYK------LPMWIKGLP------------------GDTDYQINPNGQ-VTQIKT-----A----QWQMQYQTYQPv 165 Tolumonas a...
A0KN00           120 NIPVAG------LPEWIKGLP------------------GQAEFELNPDRS-LASVRD-----G----QWQIVYGDYRDq 165 Aeromonas h...
1IWM_A           159 -----TQPAMPANMELtdGGQ----RIKLKMDN 182
CAS:Atc_0462     172 -----GGLQMPSLLQA---DGpdgvRLRLAVTR 196 Acidithiobacillus caldus SM-1
jgi:Glov_2189    188 -----DGVLVPMELQM---ESaegdRIRLTLEE 212 Geobacter lovleyi SZ
Q74FZ5           175 -----EGVPFPALVEF---SDshgvRVKITFDE 199 Geobacter sulfurreducens
chanu:ambt_11170 171 ttpegNNVWLPHAINLv-QPNppstQLKIKIYE 202 Alteromonas naphthalenivorans
WP_007638572     176 -----DEIWLPHKVVL--NDSlnnsQLLIRINQ 201 Paraglaciecola psychrophila
Q15SQ7           189 -----DDVWLPHNIKL--NNSalgnQILIRVNQ 214 Pseudoalteromonas atlantica T6c
IBRC:GU3_06255   155 -----DGLWLPSRMEL----ShdttTLKLAVSR 178 Oceanimonas sp. GK1
C4LBL3           166 -----DGWMMPENITF----KgqqtELRLVINE 189 Tolumonas auensis DSM 9187
A0KN00           166 -----DGYRLPHLLTM----TgqgsRLKLQINQ 189 Aeromonas hydrophila subsp. hydrophila ATCC 7966
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap