2W7Q


Conserved Protein Domain Family
LolA

?
pfam03548: LolA 
Click on image for an interactive view with Cn3D
Outer membrane lipoprotein carrier protein LolA
Statistics
?
PSSM-Id: 397559
Aligned: 31 rows
Threshold Bit Score: 137.056
Threshold Setting Gi: 7388445
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2W7Q_B  31 NKAQTLTARFSQLTLDGSGTRLQETAGQLSLKRPGLFRWHTDAPNEQLLISNGEKVWLYDPDLEQV--TIQK--LDQRLT 106 Pseudomonas aeruginos...
Q9PDC7  34 RGLKTLQGHFSQEIIDTQGRVKERSNGTVALSLPNLLRWECDAPYKQLVVADGKRVWLFDPDLNQA--SVRL--QGNEER 109 Xylella fastidiosa 9a5c
Q9A261  54 QGLSSAKGRFVQTDQRGT-----QTQGTFYLQRPGKARFAYDPPAGLLVVSNGNNVNIFDSRLKTY--------ESYPLS 120 Caulobacter vibrioides
Q89WR1  85 SSLSTLVGNFVQVGPDGS-----KTQGDFYIQKPGKVRFEYDAPSPIDIVADGSSLVVRDRKLATQ--------DVYPLS 151 Bradyrhizobium japonicum
Q6ND29 147 SSLQTLVGQFVQVGPDGS-----KLTGDFYIMKPGRVRFEYDDPSPISMIADGQSVVVRDRKLATQ--------DVYPLS 213 Rhodopseudomonas palu...
Q92L88  54 SSVKTMAGEFVQFGPRGE-----QTGGKFYIRRPGRIRFNYEAPSPMRVIADGKSVVIGNMKLKTW--------DIYPLS 120 Sinorhizobium meliloti
Q2YR66  65 sSARTMTGEFVQFGPRGE-----QTGGTFYIERPGKIRFNYNN-SPIRVISDGDSVVINNRKLDTW--------DLYPLS 130 Brucella abortus 2308
Q6AM51  38 RQAEAFSTDFIQEKHLAMLNKPVIFRGHLSLIRPDKLRWQFTSPLPSALIFNGEQGMRCDSEGEATpfLLSSdpVMRVVA 117 Desulfotalea psychrop...
Q9ZCA2  35 RTIKSVAIDFTQEDSYGK-----IVKGKLLIQKPYNFRCNYYPPFPLVIIGTKNFVSMYDYDMEQV--------SRISPS 101 Rickettsia prowazekii...
O67459  33 ENTKTIKVSFVQKVKYEWYPKADVSKGIFYASKGGKVRIDYYSPDRVSIFVDRKKVVLVNFEEKVV--YIES--IKRNTS 108 Aquifex aeolicus VF5
2W7Q_B 107 QTPALLLSg--DISKISESFAIT--YKEGGNVVDFVLKPK-TKDTLFDTLRLSF-RSGK-VNDMQMIDGVGQRTNILFFD 179 Pseudomonas aeruginos...
Q9PDC7 110 NSPLIALI---DPIQLDLKYDVSeeVAMRDGLRWLSLRPRvGIEASFQSASFGFaQTQ--LARMELVDNLGQRTVIVFSG 184 Xylella fastidiosa 9a5c
Q9A261 121 KTPLNLLLa--REVRLDRGVVITd-VRPLADGFTIVAQDA--KRQALGRISIDFsNGLVgLMGWTVTDIKGGQIRVRLSD 195 Caulobacter vibrioides
Q89WR1 152 QTPLRFLLs--DRIDLMKDTNVVn-VSADDVFVSVTIEEK-QALVGTSRLLLMFgAKDGqLKQWTVTDPQGYDTTIAVYN 227 Bradyrhizobium japonicum
Q6ND29 214 QTPLRYLLs--DRLDLLRDTNVVs-ITSDDLYSNIIIEEK-NAVIGTSRLLLMFgTKDGqLKQWTVTDPQGYDTTVAVYN 289 Rhodopseudomonas palu...
Q92L88 121 KTPLNLLLs--ERIDLRSRMVRD--VRVEADLITIVLGDR--SIFGDSTITMMFdPKSYnLRQWTITDAQKKDTSVMIFN 194 Sinorhizobium meliloti
Q2YR66 131 KTPLKLLLa--DRIDLGGGRLQS--VKQEPDMTTLVLGDK--SVFGDSKITMMFdPKSYdLKQWTITDAQKLDTTVMIFN 204 Brucella abortus 2308
Q6AM51 118 EQLWNWLGg--DYLKLSKLYRLS---KMEPASLVIHFDKEgAISKILSRVTIRFnEKSLqPEQVKIVERGGDFTRIFFKN 192 Desulfotalea psychrop...
Q9ZCA2 102 ENIFNFLLe--DNVDFDKDFVFEs-VINKGNIFNITIYHT----RTEKRSEITFnKNIKqIEKLKIFEDH-NIVTITFDK 173 Rickettsia prowazekii...
O67459 109 PVIASLFFlseQPEKVFKPi----gEFKEGDKTVLLLKPL-KKDENVKEVKIYFsKDGE-ILGLKTYDAQGSEISINFIE 182 Aquifex aeolicus VF5
2W7Q_B 180 VKMNEALDAKQFTFD 194 Pseudomonas aeruginosa PAO1
Q9PDC7 185 WQRNPVFAVDTFRFT 199 Xylella fastidiosa 9a5c
Q9A261 196 FAETADLDPKLFVLT 210 Caulobacter vibrioides
Q89WR1 228 LDATKKLDPGMFKID 242 Bradyrhizobium japonicum
Q6ND29 290 LDTTRRPDPSMFKID 304 Rhodopseudomonas palustris
Q92L88 195 VRTGIALDDKVFRIP 209 Sinorhizobium meliloti
Q2YR66 205 VRTGVRFTNDMFKID 219 Brucella abortus 2308
Q6AM51 193 PQLNIPLADDLFSRC 207 Desulfotalea psychrophila
Q9ZCA2 174 ITKVQKFSDDLFKFK 188 Rickettsia prowazekii str. Madrid E
O67459 183 VVRNYTPTDELFKPS 197 Aquifex aeolicus VF5
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap