Conserved Protein Domain Family
Treacle

?
pfam03546: Treacle 
Treacher Collins syndrome protein Treacle
Statistics
?
PSSM-Id: 397558
Aligned: 11 rows
Threshold Bit Score: 164.47
Threshold Setting Gi: 1191861763
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_021581350  318 T-VTPGKAGPVATQTKVGKPKEESESSSEE---ESDSEEDNPAATA----LLQAKPSEKSPQVRAVST-PAKESPRKGAP 388  thirteen-line...
XP_008253479  314 TpAPPRKAGLVAPQAKAGRPEEDSGSSSEA---SSDSEEETPAART----PLQAKPPGKTPQVRAAFA-PAKGSPRKGTL 385  rabbit
XP_020940681  319 TpAPPGRAGPAAARDKVVKPEEGSESSSEEassSSDSEEEAPAAKT----PPQAKPPGKVPGVRATSAaPAKESPRKGAP 394  pig
2_pfamImport    1 TpALTGKTGPAAAQAKAGRPEEDSESSSE----ESDSEEETPAAKT----PLQ--PSGKTPQVKAASV-PTKESPRKGTT 69  
XP_017456379  304 isATPEKTGPITPQAKTGRPQKDMETSSED---DSDSEDEMPVTVT----TPQARPSGKSPQVRGTSA-PAKESSQKGAP 375  Norway rat
NP_035682     321 IlATPGKTGPAATQAKAERPEKDSETSSED---DSDSEDEMPVTVN----TPQARTSGKSPRARGTSA-PAKESSQKGAP 392  house mouse
EHB16003      452 ppAYPGKTGPAGTQAQVGKQEEDSDSSSE----ESDSDEETPAAQTlttnPSQVKPLGKTPQVTAASA-PAKGSPRKEVP 526  naked mole-rat
XP_023361283  518 pafsvpqvkmepsvaqarigpsaiawepgssesssesseesgieeeiktpqgkekspvkilqnnaitkkvasdpsqgpqg 597  Tasmanian devil
XP_025864436  317 TpAPPGKAGPLAAQAKTGKPKEDSDSSEE----DSDSEEEPPAAKT----PLQVKPSGKTPQVKAASA-SAKESPRKGVP 387  red fox
XP_023371269  182 TlAPSGKAGPIATQAKAGKPKEDSESSSEE---ESDSEEEIPAAKA----PLQARLSEKAPQVRAASA-SAKESPRKGAA 253  small-eared g...
XP_010590174  313 aiATPVKAG--ATQAKAGKPEQDSESSSEE---ESSSEGETPAPMA----PLQMKPSGKASQVRAASA-PAKGSPVKGAA 382  African savan...
XP_021581350  389 PVPPGKTGPAAIQASAGKPEEDSDSSS-EDSDS-ERTPVAMTLTVNPAQAKSLGKNLQMKPA------------------ 448  thirteen-line...
XP_008253479  386 PVAPGKTGPAATQAQVGKLEVDSESSS-KESDSdEETPAAMGVTVSPAQVKPSGKNSWVRPA------------------ 446  rabbit
XP_020940681  395 PA------PASRAAQAGQREEDSESSS-EESDAgGQAAAAAPQTSSPALVKPMGQNSHGRAP------------------ 449  pig
2_pfamImport   70 PAPPGKAGPVAAQAKAGRPEEDSESSS-GESDSdGEAPAARPLTSSSAQVRSLLWPVLLLCTsspcpplsshtcplwspc 148 
XP_017456379  376 AVTPGKTRPVAAQAQAGKPETRSSEES--ESDS-GETPAAGTLTTSPAKVKPLGKSPQVRPA------------------ 434  Norway rat
NP_035682     393 AVTPGKARPVA--AQAGKPEAKSSEES--ESDS-GETPAAATLTTSPAKVKPLGKSSQVRPV------------------ 449  house mouse
EHB16003      527 PAYPGKTGPAGTQAQVGKQEEDSDSSS-EESDSdGETPAAQTLTTNPSQVKPLGKTPQVTAA------------------ 587  naked mole-rat
XP_023361283  598 kealstlgksrtrtveirvplavdssgsettesseesegeeetstLQTQVRPSGKTP-VKATlaplpknll--------- 667  Tasmanian devil
XP_025864436  388 PVPPSKVGPAAGQAKKGAGEEDPDSST-EESDSeEEAPTAVPPTRSPVQAkPSGQNSQVRTA------------------ 448  red fox
XP_023371269  254 PALPGKTGPAAAQAQVGKQEEDSESSS-EESDSeGETPA----AASPAQAKPLGKNPQVRPA------------------ 310  small-eared g...
XP_010590174  383 PAPPGKTGPGA--APAGKPEEDLQSSSeEESDSgEETPAAKTVTVSTAQAKPSGKTPQVRPT------------------ 442  African savan...
XP_021581350  449 ----------------------STVVQGPLGKGISPVV---PAA--------QVKKVEKASESSS-EESDSEEEAPPATL 494  thirteen-line...
XP_008253479  447 ----------------------PTVGAGPSGKGTGLAP---PGKaapaapltQVVKPEDESDSSSeEESDSEGETTPAVS 501  rabbit
XP_020940681  450 ----------------------RALA----GKGAVPAL---PGQa-----------gQQDSGSSS-EDSDSGDSEEEAAT 488  pig
2_pfamImport  149 pdpvlchsqakplgknsqvraaSTVGMGPSGKGAVPAP---PGKaastatlvLVGKQEEDSESSS-EESDSEREAPA--- 221 
XP_017456379  435 ----------------------STANLGSSRKGANPPC---LGKvgsavlkvQTGKEEEDSESSS-EESDSDGAVNAA-- 486  Norway rat
NP_035682     450 ----------------------STVTPGSSGKGANLPC---PGKvgsaalrvQMVKKEDVSESSS-AELDSDGPGSPA-- 501  house mouse
EHB16003      588 ----------------------SAAAKGSPRKEVPPAY---PGKtgpagtqaQVGKQEEDSDSSS-EESDSDGETPGAQT 641  naked mole-rat
XP_023361283  668 -------------ekgalqpsgKTVTAAPSAEGASPAKgvgPGG-------------SEDSSESS-DESESEVETPTS-- 718  Tasmanian devil
XP_025864436  449 ----------------------SGPVKGP--------PqkaGPAatp------------------------vgkQEEDSG 474  red fox
XP_023371269  311 ----------------------STMSVGPSGKGAIPVS---PGKagttgplaQVGKKKDPTSSS--EESDSEGEAPMPAA 363  small-eared g...
XP_010590174  443 ----------------------SALGTGPSGKGAILAP---PGKaapvvpqaQVGKPEEDSESSSeEDSDSEGEAPAAVT 497  African savan...
XP_021581350  495 a---------------QAKLSGK----------------------TTPVRPASGSAKGhlgkVAAPAPPQ---------- 527  thirteen-line...
XP_008253479  502 a--------------tQAKPPGK----------------------ILQVRPASGPTKGplgkDVAMAPSQ---------- 535  rabbit
XP_020940681  489 ----------------TAKPSEK----------------------VLPARTASGPSTG---------PPQ---------- 511  pig
2_pfamImport  222 ----------------QAKSSGK----------------------ILQVKSATGPAKG---------PPQ---------- 244 
XP_017456379  487 ----------------KAKPPGR---------------------------------------KATPALPR---------- 501  Norway rat
NP_035682     502 ----------------KAK--------------------------------------------ASLALPQ---------- 511  house mouse
EHB16003      642 ltt----------nssQAKPSGK----------------------ILQVRPASGPTKGllgkGAAPKPPQ---------- 679  naked mole-rat
XP_023361283  719 ----------------QGQvrnlrenqpltetkpsvkapqintsaqkldTITSISSKGtqgrVSTP-APC---------- 771  Tasmanian devil
XP_025864436  475 ssseeeesdsegaapaQAKSSGK----------------------IPQVRAASGPAKG---------PPQ---------- 513  red fox
XP_023371269  364 l--------------tQAKPLGK----------------------NPQAKSASGPARGplgkGTVPVAPQ---------- 397  small-eared g...
XP_010590174  498 -------------------------------------------------------------------PVQakpsgktvqv 510  African savan...
XP_021581350  528 ---------------------KAGPGVSQVKAE---RSKEDSESSETSS-DSEEEASAAVTPA-----QAKPALKTpQTK 577  thirteen-line...
XP_008253479  536 ---------------------KLGPGATQVKAE---RAKENSESSEESS-DSVEEAPTATTPA-----QAKPALKT-QAK 584  rabbit
XP_020940681  512 ---------------------KARPAATQVKAE---R----SESSEESStDSEEEAPAAAAAA-----QAKPAVKTpQTK 558  pig
2_pfamImport  245 ---------------------KTGPVATQIKVE---RSKEDSESSEDEI-GGGREFRILLQLLtslcpQAKPAMKTpQTK 299 
XP_017456379  502 ---------------------KTGPVATQVKTD---KGKDHAESSEEST-DSEEEAAPAASAA-----QAKPAPIK-QMK 550  Norway rat
NP_035682     512 ---------------------KVRPVATQVKTD---RGKGHSGSSEESS-DSEEEAAPAASAA-----QAKPALEK-QMK 560  house mouse
EHB16003      680 ---------------------KSGPVAIQVKAE---KSKDDSESSEESS-DSEEEAPAAVTPA-----QAKPELKMpQTK 729  naked mole-rat
XP_023361283  772 ---------------------KSGTLPLQAKTAgpgRPEDTSESSEES--ESEEESPA--SRG-----QAKSTMKAsQVN 821  Tasmanian devil
XP_025864436  514 ---------------------KAGPAATQAKAE---MSKDDSESSEEES-ESEEEAPAAMAPV-----QAKSTVKTpQTK 563  red fox
XP_023371269  398 ---------------------KAGPVATQVKAE---SSKEDSESSEESS-GSEDEAPAAMPPA-----QAKPALKT-QTK 446  small-eared g...
XP_010590174  511 rpasgpikgplgkgatpvppqKAGPVATQVKAE---RPKEDSESSEES--ESEEEAPAATTPA-----QAKPAMKTpQPK 580  African savan...
XP_021581350  578 ASPKK-GTPITPVSSKIPPVHVGTPAPWKAGTMTS---SSSPAVAWSTQKPEEDSSSSSEEES---EEEgkSACVAAVAq 650  thirteen-line...
XP_008253479  585 ASPKK-GTPVTPANTKVAPMRVGTPAPWKAGTATSpatASSPAVAWGARRPQEVSSSSEESES---EEE--TAPAATVT- 657  rabbit
XP_020940681  559 ASPRK-GGPVTPASAKAAPVRVGTPAPWKAGa-----tTASPATAKAAQRPEADSSSSETSESe-eEEE--EAPPAA--- 626  pig
2_pfamImport  300 ASPTK-GSPVTPASAKVPAARVGTPAPWKAEAVTSpacASSPAVARGTQRPEQDSSSSEESES---EEE--KAPAVAVGq 373 
XP_017456379  551 ASPRK-GTAASTTGA-------SASSPRKAGTKTSsasLSSLALPKGTQKPDVDSSSEWESEG--------AAPGTTGVq 614  Norway rat
NP_035682     561 ASSRK-GTPASATGA-------STSSHCKAGAVTSsasLSSPALAKGTQRSDVDSSSESESEG--------AAPSTPRVq 624  house mouse
EHB16003      730 ASPSK-SILLTPTSAKGAPVRVGTPAPWKAGTVAS---ASSSAVPRGAQRPKDNSSSSEEESE---GKE--ATPAAAVAq 800  naked mole-rat
XP_023361283  822 TPPGK-GAPLTPLASQGTQGRVSTPAPCKSGTLPLqakAAGPV------RPEDTSESSEESES----EE--ESPASQ-Gq 887  Tasmanian devil
XP_025864436  564 ASPKK-GTPITPTPAKAPPVRVGTPAPWKARAEASlacASSPAMARGAQKPEA-SSSSEESES---EEE--TAPAPAAGq 636  red fox
XP_023371269  447 ASPRKgGTPGTLTSAKVTP--VGSQAPKKGA-------ASSPAVARSVQRPEKDSSSSEESDSe--EEE--TAPVAAa-- 511  small-eared g...
XP_010590174  581 ASPRK-NTPITPASAKLPPMQVDTPAPWKAGTATSpacTASPATARGAQRPQEESSSSEGSESeeeEEE--TAPVATAGp 657  African savan...
XP_021581350  651 vkSVGKGLQ-----ARAAlvptkapsgQGTAPAPPRKTGPSVsQVRAQDSED-SESSEEESDS---EEEAATPAP----- 716  thirteen-line...
XP_008253479  658 --SVGKGLQ-----AKAA---------PATTPLLPGKMGPAV-QIKAKAHED-SESSEEESDS---AQAASTPAQ----- 711  rabbit
XP_020940681  627 ----------------AA-------------------------------------------------------GR----- 630  pig
2_pfamImport  374 akSVRKNPP-----AKAAsaptkgpsgQGNAPLLPGKAGPAVaQVKAEMHDD-SESSEEESDS---EEVAATPAQ----- 439 
XP_017456379  615 gkSGGKGLQ-----GRAAs-------gQGVAPLHAQKTGPSGaQVKATAQED-SESSEEESSS---EEEDETPAQ----- 673  Norway rat
NP_035682     625 gkSGGKGLQ-----GKAAl-------gQGVAPVHTQKTGPS---VKAMAQED-SESLEEDSSS---EEEDETPAQ----- 680  house mouse
EHB16003      801 akSLGKGLR-----GQAAsaptmgpsgQGATPVPPGKTRPTVaQVRAEAHES-SESSEEESDDs-eVGAVVTPAQ----- 868  naked mole-rat
XP_023361283  888 akLAVKTPQadtisGKGTsvspkgtqgKAST-LPPLKSATVPlQAKGEVQHkigwlgkpektsessedsecedtipvsqv 966  Tasmanian devil
XP_025864436  637 akPVGKGIT-----VKAAstptkrpsgQGTALAPPGKAGPATaPVKTEVQEDsSESSEEESGSeeaEEAAAAPAQ----- 706  red fox
XP_023371269  512 -kSTGKGLQ-----VKAAsaps------tgpsVLPGKMGPAVtQVKTETQED-SESSEEDSDS---EAAAPAPAQ----- 570  small-eared g...
XP_010590174  658 akSVGKNLQ-----GKAAsapakapsgPGTAPVPPGKVGLAAaQVKTETYED-SESSEEESDSe-eAPAAVSPAQvkasv 730  African savan...
XP_021581350  717 VKALGNTVQAKASPAPIRA-------SSAKG-TSAPGKVLTavapakqgSPAK--------------------------- 761  thirteen-line...
XP_008253479  712 VQASARTPQTKASAAATKA-------SSAEGvTSPPGKVVAaaaqakqgSPAK--------------------------- 757  rabbit
XP_020940681  631 MKNSVTAPQTKATPAVPRV-------ASAKVaASAPGKGAPagaqatlgSPAK--------------------------- 676  pig
2_pfamImport  440 VRPQGASPSPPHQCPGLAD-------GGLVWaALAPGCA----------KPSG--------------------------- 475 
XP_017456379  674 VMALGRLPPAKANPPPTKT-------PLA----SASGKAAAv------vPPPK--------------------------- 709  Norway rat
NP_035682     681 ATPLGRLPQAKANPPPTKT-------PPA----SASGKAVA--------APTK--------------------------- 714  house mouse
EHB16003      869 AKAPGKTPQAKANPASTKA-------STDKEaAWTPAKL----------------------------------------- 900  naked mole-rat
XP_023361283  967 qvkpgvilptvlegkkettasspkksavpslqamkvdsssseesssssdevvmpatqrqakptmkasqvdtppgkrapvt 1046 Tasmanian devil
XP_025864436  707 VKTAVKTPQSKANQAPTRA-------TSAKGaASAPGKVVSaavqikqeSPAK--------------------------- 752  red fox
XP_023371269  571 VKASVKTPLAKANPAATRV-------SSAKGaTSAPGKGVTtaaqakqgSTAK--------------------------- 616  small-eared g...
XP_010590174  731 KTPQIKANPASPRVSSVKAaastsgkAITTGvqa------------klvSPAKasgakatrelgqrggrpsseptpdkgp 798  African savan...
XP_021581350  762 --GKPSARTPQNSTVtmkgqa-svvttGKAVAGAAQTQKGSVGRAEEEDSESSEEESDSEEEEvaPAQAKPLeNKLQQVR 838  thirteen-line...
XP_008253479  758 --VKLPVRAPQNSAL------------GKAVATTGPAQKGPVGRPQEEDSESSEESSDSEEEA--PAQVKPL-GKTPQVR 820  rabbit
XP_020940681  677 --VRPPARTPQGRPGagkgpg-avpavGKAATTAAP-QPGPVGGA-EDDSESSDGDSDSEEAA--PAQAKPT-RKTPQVR 748  pig
2_pfamImport  476 --KTPQVRTASAPTKgspqkgaapappGKTGPTASQ-----AAKREENSESSSEDDSDSEGVA--PAQAKPS-GKTTQVR 545 
XP_017456379  710 --GKAPASTVQNSTIsargqr-avpatGKAGAPATQAQKGPMAGTGEDSESSSEEESDSEEET--PAQVKPV-GKTSQVR 783  Norway rat
NP_035682     715 --GKPPV---PNSTVsargqr-svpaaGKAGAPATQAQKGPVAGTGEDSESSSKEESDSEEET--PAQIKPV-GKTSQVR 785  house mouse
EHB16003      901 --GKSPVRAPKNSTIsargqa-svpasGKAVTAAAQSQKGPTQESEEKDLESSEESSESEEEL--PTQAKPS-GKTLQVR 974  naked mole-rat
XP_023361283 1047 plstkdtqgrvstpapwksgsvplqakaagpgrpedtsesseeseseeevnpsaqipqrkaaekpaapvttveetssess 1126 Tasmanian devil
XP_025864436  753 --VKPPARTSQSNAVsvrgqg-avpavGKAVATAAQAQPGPVKNP-EEDSESSEEESDSDGEA--PTPVKPS-GKTPQVG 825  red fox
XP_023371269  617 --AKTPARTLQNSALsvrgqa-smqsvGKAG---------------EEDSESSEEESDSEEEV--PAQAKPL-GKTPQVK 675  small-eared g...
XP_010590174  799 tqVKPPMRTPQSSAIlvqgqv-svpavGKAVAVAAPAKTGAVRGPQEEDSGSSEEESDSEEEA--PAQAKPS-RKAPQVK 874  African savan...
XP_021581350  839 NASGPAK 845  thirteen-lined ground squirrel
XP_008253479  821 AASAPAK 827  rabbit
XP_020940681  749 AASAPSK 755  pig
2_pfamImport  546 TASAPIK 552 
XP_017456379  784 AASAPVK 790  Norway rat
NP_035682     786 AASAPAK 792  house mouse
EHB16003      975 AATAPAK 981  naked mole-rat
XP_023361283 1127 qdteseg 1133 Tasmanian devil
XP_025864436  826 TASAPSK 832  red fox
XP_023371269  676 AASTPAK 682  small-eared galago
XP_010590174  875 AASASTK 881  African savanna elephant
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap