1HY5,1HE1


Conserved Protein Domain Family
YopE

?
pfam03545: YopE 
Click on image for an interactive view with Cn3D
Yersinia virulence determinant (YopE)
Statistics
?
PSSM-Id: 397557
Aligned: 4 rows
Threshold Bit Score: 105.36
Threshold Setting Gi: 18655414
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1HY5_B  38 EXLQKNHDQFATGSGPLRGSITQCQGLXQFCGGE-LQAEASAILNTPVCGIPFSQWGTIGGAASAYVASG 106 Yersinia pestis
Q9I788 132 ERLAKDHTRLASGDGALRSLATALVGIRDGSRIEaSRTQAARLLEQSVGGIALQQWGTAGGAASQHVLSA 201 Pseudomonas aeruginosa
P74873 192 NSLRENFQEMASGNGPLRSLMTNLQNLNKIPEAKqLNDYVTTLTNIQVGVARFSQWGTCGGEVERWVDKA 261 Salmonella enterica subsp. ente...
1HE1_A  35 EGLAREHSRLASGDGALRSLSTALAGIRAGSQVEeSRIQAGRLLERSIGGIALQQWGTTGGAASQLVLDA 104 Pseudomonas aeruginosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap