1YRT,1S26


Conserved Protein Domain Family
Anthrax_toxA

?
pfam03497: Anthrax_toxA 
Click on image for an interactive view with Cn3D
Anthrax toxin LF subunit
Statistics
?
PSSM-Id: 397528
Aligned: 6 rows
Threshold Bit Score: 245.862
Threshold Setting Gi: 48425527
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1YRT_A        10 ANAADRESGIPAAVLDGIKAVAKEKNATLMFRLVNPHSTSLIAEGVATKGLGVHAKSSDWGLQAGYIPVNPNLSKLFGRA 89  Bordetella pert...
CAV19587      16 GDAAIEPSGIVPLHKDLIIQTAFQNNCIILVRPVNKLSTSLIAEGYATKDLHVKGKSSNWGPQSGFICCDQKFSKLFKKS 95  Vibrio tasmanie...
1S26_C         8 GEKALKASGLVPEHADAFKKIARELNTYILFRPVNKLATNLIKSGVATKGLNVHGKSSDWGPVAGYIPFDQDLSKKHGQ- 86  Bacillus anthracis
Q9I1S4        37 AQGV----GVPVEHALRMQAVARQTNTVFGIRPVERIVTTLIEEGFPTKGFSVKGKSSNWGPQAGFICVDQHLSKREDRD 112 Pseudomonas aer...
WP_015874314  79 EQKV----GIVPEHLIELQILAQKKNCIISIRPVDLMATDLIRDGHPTKGFKIKGKSANWGPQTAFICVNQALSKLADQP 154 Candidatus Hami...
CCH:MU9_1525  39 rQTVISQTGIAAEHLAPLQALAEKQQLVISFRPVEATATGLISAGYPTKNFNIKGKSANWGPMAGFIPVDQFYSKLCGQ- 117 Morganella morg...
1YRT_A        90 PEVIARADNDVNSSL--AHGH-TAVDLTLSKERL-DYLRQAGLvtGMADG------VVASNHAGyeqFEFRVK---ETSD 156 Bordetella pert...
CAV19587      96 PQEIVKFNSKVKESI--RDRFaKPVPLLISNERLnSLIKDKML--HIVSKdrgiihVTNHGKPH---HDFVLYpnaMMPF 168 Vibrio tasmanie...
1S26_C        87 QLAVEKGNLENKKSIteHEGEiGKIPLKLDHLRIeELKENGIIlkGKKEIdngkkyYLLE--SNnqvYEFRIS------D 158 Bacillus anthracis
Q9I1S4       113 TAEIRKLNLAVAKGM--DGGAyTQTDLRISRQRLaELVRNFGLv----ADgvgpvrLLTAQGPSgkrYEFEAR---QEPD 183 Pseudomonas aer...
WP_015874314 155 QKTLNKFNTAVQECL--DQKNaKEVDLKITKNRI-ELLEKEGIvyEVEKNdsgaitKLKAKTSEnveHEFTLNp-cDEGS 230 Candidatus Hami...
CCH:MU9_1525 118 KHKTELMNRKVAECL--RDGHaIADNLQITGSRInELV-DMGLltRHQPDkng-fiTLESKSPHghlHLFTAKp---AEN 190 Morganella morg...
1YRT_A       157 GRYAVQYRRKGgddfEAVKVIGN 179 Bordetella pertussis
CAV19587     169 GDYPIRYRNHQ----KNLMVMFK 187 Vibrio tasmaniensis LGP32
1S26_C       159 ENNEVQYKTKE----GKITVLGE 177 Bacillus anthracis
Q9I1S4       184 GLYRISRLGRS----EAVQVLAS 202 Pseudomonas aeruginosa
WP_015874314 231 ELYLVNYNG------APVKVLSS 247 Candidatus Hamiltonella defensa
CCH:MU9_1525 191 DLYAIYVQKDD----TPVRVLCS 209 Morganella morganii subsp. morganii KT
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap