5YHI


Conserved Protein Domain Family
3-alpha

?
pfam03475: 3-alpha 
Click on image for an interactive view with Cn3D
3-alpha domain
This small triple helical domain has been predicted to assume a topology similar to helix-turn-helix domains. These domains are found at the C-terminus of proteins related to Escherichia coli YiiM.
Statistics
?
PSSM-Id: 397512
Aligned: 88 rows
Threshold Bit Score: 30.8629
Threshold Setting Gi: 345642834
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5YHI_B           175 VTVQEAAAIAWHMPFDDDQYHRLLSAAGLSKSWTRTMQKRRLSG 218 Escherichia coli K-12
AEV75772         167 LSVADVDALLYLPDRDVSMLRQAVDVAALSPGWQQSFAELLAAG 210 Mycolicibacterium rhodesiae NBB3
jgi:Caci_3827    172 MTVEEIDAILYLPGHTRDQVERALRIPALSPGWQMSMRTLLEQA 215 Catenulispora acidiphila DSM 44928
Q021E0           171 ITVAAIDALLYLPGHPREQLESALRIPALPPGWKGSLQALLNRG 214 Candidatus Solibacter usitatus Ellin6076
Q1IN89           171 VTVADIDALLYLPGHSREVLKRALQVPALSNGWKSSLEAMLNSD 214 Candidatus Koribacter versatilis Ellin345
jgi:Terro_0394   171 VTVAEIDALLYLPGHPRDRLQNALGVPALSAGWRSSLEALLATE 214 Terriglobus roseus DSM 18391
jgi:Anae109_2815 179 MTVARVNALLYLPGHLRADLERALRIPALSPGWRGSFQAMLDHA 222 Anaeromyxobacter sp. Fw109-5
jgi:Msil_3068    172 MSVFEINALLYMPGHPRGQLERALRIPALSPGWNASFQALLQQd 215 Methylocella silvestris BL2
Q89NR8           172 MSVFEINALLYLPPHPRDRLERALRIPALSRGWNRSFASLLEQQ 215 Bradyrhizobium japonicum
jgi:Niako_4197   170 mnIAEVDALLYSKEHPKEQLQKALKIPALSKGWGQSFQDLLQSA 213 Niastella koreensis GR20-10
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap