2IHR


Conserved Protein Domain Family
PCRF

?
pfam03462: PCRF 
Click on image for an interactive view with Cn3D
PCRF domain
This domain is found in peptide chain release factors.
Statistics
?
PSSM-Id: 397500
Aligned: 918 rows
Threshold Bit Score: 152.153
Threshold Setting Gi: 328853865
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2IHR_1            22 KETRLKELERRLeDPSLW-NDpeAARKV---SQEA--ARLRRTVDTFRSLESDLQGLLELmEELP--AeeRE---Alkpe 90  Thermus the...
XP_006675984      24 VESKASDLRDRLkDDNLWtTDtkEAIEI---QKDI--SRLESEIAEHSKFTVKWNETQSM-IELAkeEgdDTllkEvvad 97  Batrachochy...
EMD39055          79 VQAELQKLQDVLkDDTTWvHDtaTALKT---QTRV--AQLEKQMETYQRIHTSHDALQDL-ASLAeeTedEQmldEiape 152 Gelatoporia...
EKM59316          69 IEEEAESLKDQLqDEKSW-EDkaQIAQTmrfQTRL--ARVEKQLSSYRQLRAAVSHVREL-AEFAdaDmqEQml----pe 140 Phanerochae...
BAN35637          73 KQERLTEVVQLLeNPAVW-DDakRAQEL---GKER--RTLEGIVDTLKNLDQSLHDSADL-FEMAkeEgdDAtleSvaad 145 Sulfuricell...
Q5NZU2            32 KSSKLEEVTRALeDPAVW-NNaeKAQEL---GKEK--RQLEDVVHNLRDIESLSSDLKDL-FDLAeaEddEDtlaAvead 104 Aromatoleum...
jgi:CAP2UW1_1030  12 KADQLKTVARELeDPAVW-DNaeRAQEL---GRER--RSLENVVLTLNRVADSLRDTGEL-FAMAreEddDEtlnAvaad 84  Candidatus ...
jgi:Dsui_2862     32 KEVRLVEVSRELeSPDVW-DDakRAQDL---GREK--KALEGVVVTLQEVAQGLADGKEL-FEIAreEgdFDtvaAvaad 104 Azospira or...
tigr:RIEPE_0123   29 KKIELTTLRNKIsSNEIW-RSkkLSSLI---GLQKlvAIKEIEIEKIEKIKQYLENIEIL-IECLkeKrdEDflkEtyrd 103 Candidatus ...
WP_012543910      29 KKAELSDVRKVYeKPDIW-SDpdKAVAV---ARKV--QRLEEEIERVEQIENLLKDLDAA-LELLqeGydEElfeHalat 101 Coprothermo...
2IHR_1            91 LEEAAKKLDELYHQTLLNFPHAEKNAILTIQPGAGGTEACDWAEMLLRMYTRFAERQGFQVEVVDLTPgPEAGIDYAQIL 170 Thermus the...
XP_006675984      98 MEDLEAQLRQYFIKSLMTDEVDQSGCYIEIRAGAGGAESCDWVSMLTRMYERWGADQGHTVTSIAQVKgDVAGLKSSTTQ 177 Batrachochy...
EMD39055         153 LEELQTTTDRYLISLWLSEPVDAKSAYIEIHAGSGGTEACDWASMLARMYTKWAHSRDYTVQIIDETPgDAAGIKSTTML 232 Gelatoporia...
EKM59316         141 LDELLDTSQKTLVALWLAGPVDANSAYLDIHAGSGGTEACDWASMLARMYTRWAHSQNYTVEVFDESLgDVAGIKFTTLL 220 Phanerochae...
BAN35637         146 AEALEKTVAEMEFRRMFSHPMDPNNCFIDIQSGSGGTEAQDWASMLMRMYVRYCERKGFKVEILEESAgEVAGLKSATLK 225 Sulfuricell...
Q5NZU2           105 IGELQAKVHALEFRRMFSNPMDPNPCFIEIQAGAGGTEAQDWAGMLERMYLRYCERKGFNVELMEESEgEVAGIKGATIK 184 Aromatoleum...
jgi:CAP2UW1_1030  85 IDGIEKEVSGLEFRRMFNNPADPLNCFVDIQAGAGGTEAQDWAAMLLRMYLRYAERKGYAVEVLEESEgEVAGIKTASIK 164 Candidatus ...
jgi:Dsui_2862    105 NEAIEAKVAALEFRRMFNNPQDPNPCFLEIQAGAGGTEAQDWASMLLRMYLRYTERKGFDVQVLEESEgDVAGIKSATLR 184 Azospira or...
tigr:RIEPE_0123  104 LFNVRSMIENLKIFRLFSKENDFCDCYIDLQSGSGGIDSQDWTSMLLKMYLKWSDLKNFRSYVLNTSYgEITGIKSSTIM 183 Candidatus ...
WP_012543910     102 LKELQQRIELFRLVTLFTEPYDTNDAILMLHAGAGGVDAMDWTQMLMRMYLRWAERMGFETEIVDISRgEEAGVKSCTVF 181 Coprothermo...
2IHR_1           171 VKGENAYGLLSPEAGVHRLVRPSPFDASGRRHTSFAGV 208 Thermus thermophilus
XP_006675984     178 IQGDYAYGWSKNESGVHRFVRVSPFDSNAKRHTSFVSV 215 Batrachochytrium dendrobatidis JAM81
EMD39055         233 IEGPYAYGYAQYETGVHRLVRLSPFDKSNARHTSFASV 270 Gelatoporia subvermispora B
EKM59316         221 INGPYAYGYAQYEMGVHRLVRTSPFDSNGARHTSFASV 258 Phanerochaete carnosa HHB-10118-sp
BAN35637         226 ISGDYAFGYLRTETGVHRLVRKSPFDSGNRRHTSFSSV 263 Sulfuricella denitrificans skB26
Q5NZU2           185 VSGDYAYGFLRTETGIHRLVRKSPFDSNARRHTSFSSV 222 Aromatoleum aromaticum EbN1
jgi:CAP2UW1_1030 165 ISGEYAYGMLRSETGIHRLVRKSPFDSNARRHTSFCSV 202 Candidatus Accumulibacter phosphatis clade IIA str. UW-1
jgi:Dsui_2862    185 IAGDYAYGMLRTETGIHRLVRKSPFDSNARRHTSFTSV 222 Azospira oryzae PS
tigr:RIEPE_0123  184 IKGRYAYGWLRTETGIHRLVRKSPFDSSGRRHTSFSSV 221 Candidatus Riesia pediculicola USDA
WP_012543910     182 VRGSYAYGYLRAEKGVHRLVRLSPFDADHRRHTSFALV 219 Coprothermobacter proteolyticus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap