1XI8,2NRP


Conserved Protein Domain Family
MoeA_N

?
pfam03453: MoeA_N 
Click on image for an interactive view with Cn3D
MoeA N-terminal region (domain I and II)
This family contains two structural domains. One of these contains the conserved DGXA motif. This region is found in proteins involved in biosynthesis of molybdopterin cofactor however the exact molecular function of this region is uncertain.
Statistics
?
PSSM-Id: 397492
Aligned: 1196 rows
Threshold Bit Score: 58.718
Threshold Setting Gi: 636753727
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1XI8_A           24 VLndlkeieeVEY---VPLkdaL---GRVLAEDIVASYDLPPFDRAAVDGYA-V--------------------RAEDTF 76  Pyrococcus f...
CDC54865         19 PE--------TQTiehILL---QdafERIIAEDITAKIPVPSFAKSAYDGYA-LrqadtaaaspehpvtldvteVIPAGS 86  Dorea formic...
WP_012389707     10 LVlketksygTEF---IPLsqsM---GRVLSENILADRDYPPFHRSAMDGFA-I--------------------SHKDYV 62  Leptospira b...
jgi:Turpa_2484   25 LIlaearsfgTER---IALersF---GRVLAENVRADRDYPPFNRSAMDGYA-I--------------------VADQCA 77  Turneriella ...
jgi:Sph21_3752   10 LIssstkklhQMT---ICLsdaS---GYRLAQEVRADRPYPPYNRAAMDGIA-I--------------------RFQDYL 62  Sphingobacte...
EHQ29171         10 LItslsrsfgTEY---ISLddaD---GRVLAEDVAADRDYPPFNRATMDGYA-I--------------------STADWE 62  Mucilaginiba...
Q11VG5           17 ET--------TPTq--IPL---LesiGNFYSADISADRNYPPFNRAAVDGIA-F--------------------YWDGIS 62  Cytophaga hu...
jgi:Selin_0098    9 pqaseliarhtaplevVSLp-hNeaqDHVLARDVLTHHAYPDVKKAAVDGFA-I--------------------SEEDRL 66  Desulfurispi...
WP_013007551     24 EV--------KAKs--INVi--Ks-fNYVLAEDIVTIRDYPDTKKSAVDGFA-I--------------------KGLDRN 69  Deferribacte...
jgi:Flexsi_2240  17 NF--------KTEr--VAVneaF---NRALAEDLYTDFPFPDCRKSAVDGYAiV--------------------IWDKME 63  Flexistipes ...
1XI8_A           77 EAreyspvelev---ieevpigenPNKEVIAGkAIKVLTGGKIPRGA--NAVIMQEMvkr--------------egSKIY 137 Pyrococcus f...
CDC54865         87 VP----------------------TYPITEGK-AARIMTGAPVPEGA--DAIIMHERt-----------------sFTEN 124 Dorea formic...
WP_012389707     63 KDlsyfyqr---------elhagsTFTKLPGEtVIRIMTGAPVPDGF--DAVIKIEDaipsek-------ngiksvSFPM 124 Leptospira b...
jgi:Turpa_2484   78 TEklydvvgklfaggaapahlsrlRGGQKATPaALKIMTGAAVPEPF--DAVIRREDareta----------gqqvSFTS 145 Turneriella ...
jgi:Sph21_3752   63 DGvqnfniqe-------viyagsaSEGVLTHGnCYKIMTGAAVPSSA--DTIVRNEDllyv-----------ankaSIVH 122 Sphingobacte...
EHQ29171         63 SGtrafkvqq-------viyagqvGEAGLQAGyCYKIMTGAPVPLSA--NAVIRREDatqv-----------dgnvSFSL 122 Mucilaginiba...
Q11VG5           63 PVkesyqiag------sifagemwQKDIQAFE-CVWIMTGAPVP--KqlNMLVRVEDisaqnnhiyfrkgltftrmQ--- 130 Cytophaga hu...
jgi:Selin_0098   67 NGvrhftvqe------qvgaghrfSTTLTSGK-AIHVMTGAEVPENS--GFVVRVEDavqegdhia--lsqeygsqE--- 132 Desulfurispi...
WP_013007551     70 SYrivntf-----------spgmqVDINLGKGeAVFVMTGAVVPENA--DAVVRVEDcvidgdiv----tincnltN--- 129 Deferribacte...
jgi:Flexsi_2240  64 YTikges------------vpgdlRNADIQAGeCIFVMTGGIVPDNT--DAVVRVEDveeendhi----llnrkpeK--- 122 Flexistipes ...
1XI8_A          138 V--LRPVAPGQNISFAGEDVKKGDIALKKGTILRPQDLALLKAL 179 Pyrococcus furiosus
CDC54865        125 TvtLTAPVTSANIIPPGEDVAAGTLLVPKGKILTASDLALIAGQ 168 Dorea formicigenerans CAG:28
WP_012389707    125 D----GISLWQNIAKQGEDAKQNDSLLPIGTKLDISEVSLLASL 164 Leptospira biflexa
jgi:Turpa_2484  146 E----SILPWHNISRQGEDLQRGSTLALAGSAVDPSSVTLLASL 185 Turneriella parva DSM 21527
jgi:Sph21_3752  123 H---EKIKSHANIALRGQDLQSGEVVIPSNTYITPSIISLLATL 163 Sphingobacterium sp. 21
EHQ29171        123 E----TMRPYQNIARQGEDIKAGTGILSANTLCTPAVVSLLATL 162 Mucilaginibacter paludis DSM 18603
Q11VG5          131 -----------NIAKEGEDILKDTVVLTKGMRITPQHVSTLASL 163 Cytophaga hutchinsonii ATCC 33406
jgi:Selin_0098  133 -----------NICQPGEEAHGEDIALKAGTWLNWARMPLIHYL 165 Desulfurispirillum indicum S5
WP_013007551    130 ---------GMNINNIGEEVGINQHVVTKGVLINERIFPILCYL 164 Deferribacter desulfuricans
jgi:Flexsi_2240 123 ---------GVNINLAGEEFSENTLFAEHGKLLDELAFPALcys 157 Flexistipes sinusarabici DSM 4947
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap