3Q3C,5JE8,2UYY,6FQX,2P4Q,1PGP


Conserved Protein Domain Family
NAD_binding_2

?
pfam03446: NAD_binding_2 
Click on image for an interactive view with Cn3D
NAD binding domain of 6-phosphogluconate dehydrogenase
The NAD binding domain of 6-phosphogluconate dehydrogenase adopts a Rossmann fold.
Statistics
?
PSSM-Id: 397486
Aligned: 132 rows
Threshold Bit Score: 110.246
Threshold Setting Gi: 74562498
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3Q3C_A           4 QIAFIGLGHXGAPXATNLL-KAGYLLNVFDLVQSAVDGLVAAG-----ASAARSARDAVQGA----DVVISXLPASQHVE 73  Pseudomonas a...
Q8SRX1           8 EIGLIGLGVMGHSLALNIV-SRGYRLHVFNRTSSKTDDLVRERr---dICPHYSVEDLVVGIktspRVILLMLTSGKVVD 83  Encephalitozo...
tigr:GBAA_0164   5 QIGVVGVGVMGKSLALNFE-SKGYSVALYDISKEKVDETI-EEnrgknLVGTHIVEEFVNSLes-pRKILLMVNAGEITD 81  Bacillus anth...
Q83G38           4 DIGVYGLAVMGSNLARNFA-GKGIRVAIHNRSSDRSNSLAQQHse-cnFIVAKDDKDFIDSLss-pRTVLLMVKAGSIVD 80  Tropheryma wh...
Q6ADQ1           9 NIGVVGLAVMGSNLARNLAsREGNTVAVYNRTFARTEDLVGAHpe-agFVASESIDDFVASLat-pRTAIIMVQAGKGTD 86  Leifsonia xyl...
Q8G729           7 NIGVIGLATMGSNLARNLA-HHGNTVALFNRHYSRTEKLMNEHgtegnFVPAETLEEFAASLkr-pRTAIIMVKAGAPTD 84  Bifidobacteri...
Q9CBE9          12 QIGVTGLAVMGSNIARNFA-RHGYTVALHNRSIAKTDTLLKEHgsegnFVRTETIPEFLAALqt-pRRVLIMVKAGDATD 89  Mycobacterium...
Q6NHC5           9 QIGIVGLAVMGSNLARNFA-HKGHTVAVFNRSFEKTQALMDQHgdegnFIPSATIEEFVASLek-pRRAIIMVQAGPATD 86  Corynebacteri...
Q8FTI1          15 QIGVVGLAVMGSNLARNFA-RNGHTVAVYNRSTDKTDKLISDYatdgnFIPTKTVEDFVAALek-pRRAIVMVQAGAATD 92  Corynebacteri...
Q826E4           6 QIGVTGLAVMGRNLARNFA-RNGYTVAVHNRTASRTRDLVEEFghegdFVPAETAKDFVAALer-pRRLVIMVKAGAPTD 83  Streptomyces ...
3Q3C_A          74 GLYLDddgLLAHIAPGTLVLECSTIAPTSARKIHAAARERGLAXLDAPVSGGTAGAAAGTlTFXVGGDAEALEKARPLFE 153 Pseudomonas a...
Q8SRX1          84 VFLEE---LSRYLGKDDVVIDGGNSSYKDTIRRNRY----KFGFVGCGISGGEEGARYGP-SIMVGCDKDSWEKVQGFLT 155 Encephalitozo...
tigr:GBAA_0164  82 KAIDS---LVPHLDKGDILIDGGNTYFVDTIRRNKRLAEEGINFIGAGVSGGEEGALKGP-SIMPGGQKDAYEKVKDMLE 157 Bacillus anth...
Q83G38          81 EVIAR---LSTFMQPGDVIIDGGNSLYTDTIRREEELKARGLHFIGLGVSGGEVGALEGP-SLMPGGSDYAYSIVGPMLE 156 Tropheryma wh...
Q6ADQ1          87 AVIDQ---LVERFEPGDIIVDGGNANFLDTIEREKRVSATGVHFVGAGISGGEEGALKGP-SIMPGGTAESYKTLGPILA 162 Leifsonia xyl...
Q8G729          85 ATIAQ---LEEVFEPGDIIVDGGNSFFKDTIKREKEVRAKGFHFVGCGVSGGEEGALNGP-SLMPGGTAESWKTLGPILQ 160 Bifidobacteri...
Q9CBE9          90 AVINE---LADVMEPSDIIIDGGNSLFTDTIRREKAMRERGLHFVGAGISGGEEGALNGP-SIMPGGPAESYTSLGPLLE 165 Mycobacterium...
Q6NHC5          87 AVINQ---LADAMDEGDIIIDGGNALYTDTIRRESEIAQRGLNFVGAGISGGEEGALNGP-SIMPGGPDKSWEALGPLLE 162 Corynebacteri...
Q8FTI1          93 AVINQ---LADAMEEGDIIIDGGNALYTDTVCREKEMAARGRHFVGAGISGGEEGALNGP-SIMPGGPKESWEALGPLLE 168 Corynebacteri...
Q826E4          84 AVIEE---FAPLLEPGDMIIDGGNAHFADTRRRERELREQDIHFVGTGISGGEEGALHGP-SIMPGGSPESYDSLGPMLE 159 Streptomyces ...
3Q3C_A         154 AXGR--------NIFhA-G 163 Pseudomonas aeruginosa
Q8SRX1         156 DISAvevsgskrCCV-WlG 173 Encephalitozoon cuniculi
tigr:GBAA_0164 158 NISAkvn--nepCCS-YiG 173 Bacillus anthracis str. 'Ames Ancestor'
Q83G38         157 KIAAran--gepCVA-HiG 172 Tropheryma whipplei str. Twist
Q6ADQ1         163 SIAAiae--gepCVT-HiG 178 Leifsonia xyli subsp. xyli
Q8G729         161 SIAAkvn--gepCVT-HiG 176 Bifidobacterium longum
Q9CBE9         166 EISAhvd--gvsCCT-HiG 181 Mycobacterium leprae
Q6NHC5         163 SIAAqvg--gtpCVT-HiG 178 Corynebacterium diphtheriae
Q8FTI1         169 SIAAkvd--gvpCVT-HiG 184 Corynebacterium efficiens
Q826E4         160 KISAkaad-gapCVT-HvG 176 Streptomyces avermitilis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap