Conserved Protein Domain Family
CBM_17_28

?
pfam03424: CBM_17_28 
Carbohydrate binding domain (family 17/28)
Statistics
?
PSSM-Id: 397477
Aligned: 6 rows
Threshold Bit Score: 304.444
Threshold Setting Gi: 315475010
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Clocel_3662 346 LWADNELTTSGQYVRARIKGAYYaTPVDPVTNQPtapkdFSSGFWDFNDGTTQGFGVNPDSPIT--AINVENANNALKIS 423  Clostridium...
WP_012634873    353 VWSPKELSVSGEYARARIKGIKY-EPIDRAEKEE-----FTTNVWDFNDGTTQGFGINGDSPVKadSITIANEKNTLKIT 426  Ruminiclost...
WP_010076484    356 LWSPNEISPAGEYYRARIKGITY-NPIDRKKVD------FTTNLFDFDDDTTQGFGINRDSFVK--SVMLSNENKALKLN 426  Clostridium...
jgi:Deipe_1290   25 krlsttavVSGEYVRARIKGVPY-RPIDRTA--------YAELAWSFEND-TQGFGVNSDSPDK--TVTVTHDRGALKLS 92   Deinococcus...
jgi:Bcell_3370  400 VWSMEELSVSGEYVRSRILGEEY-QPIDRTPREE-----FSEVIWDFNDGTTQGFVQNSDSPVD---VTIENVNDALQIT 470  Bacillus ce...
jgi:Bcell_3371  388 VWTKEQLSLSGEYVRSRIIGEEY-EPIDRTPRET-----FTEVIWDFNDGTTQGFGVNAGSTLE--GFTVTNENNALQIA 459  Bacillus ce...
jgi:Clocel_3662 424 NLNSkgSNDLS--EGNFWANVRISADIWGQSINIYGDTKLTMDVIAPTPVNVSIAAIPQSSTHGWGNPTRAIRVWTNNFV 501  Clostridium...
WP_012634873    427 GLNT--SKDLT--EGNYWANVRLSADGTSNKPNILGAEKLTMDIITAAPATVSIAAIPQNSTHGWANPTRAIAVKPADFV 502  Ruminiclost...
WP_010076484    427 GLSA--SNDIS--DYNFWGNARLSAEASGLYKDIKDAENLTMDVITATPATVSIAVVPQSYYHSWIDPKNAVQVVPEDFK 502  Clostridium...
jgi:Deipe_1290   93 SLGA--SNDVS--TGGFWSNLRISADGSSVKPNILGAKSISMDVFVPAPTTVSIAAVPQSSNNGWTSPARAVVLTADQFT 168  Deinococcus...
jgi:Bcell_3370  471 GLDE--SNAIAgeEEDYWSNVRISADEWEETFDILGAEELSMDVVVDDPTTVAIAAIPQSSAHEWANASNSVLITEDDFE 548  Bacillus ce...
jgi:Bcell_3371  460 GISE--ANSV-------W-DVRISADNWDETVDIAGAQELSMEIIVDEPTMVEIGAIPQSASAGWANPVE-VAVSPEDFD 528  Bacillus ce...
jgi:Clocel_3662 502 AQTDGTYKATLTISTNDSPNFNTIATDAADSVVTNMILFVGSNS----DNISLDNIKFT 556  Clostridium cellulovorans 743B
WP_012634873    503 KQEDGTYKAVLTITPADSPNFDSIAKDSKDSTMTNIILFVGADT----NVISLDNITVS 557  Ruminiclostridium cellulolyticum
WP_010076484    503 LQQDGSYKATLTISSEDSPNLKAIASDSKDSILTDIVLIVGSTT----SAISIDNIAVs 557  Clostridium cellulovorans
jgi:Deipe_1290  169 LQPDQRYKATLILTDADAPNLQKIAEDETNNVLSNIIFFVGTAStasnDTVWLDNITFh 227  Deinococcus peraridilitoris DSM ...
jgi:Bcell_3370  549 EQEDGTYKALLTITGEDAPNLTNIAEDPEGSELNNIILFVGTENa---DVISLDNITVT 604  Bacillus cellulosilyticus DSM 2522
jgi:Bcell_3371  529 LQEDGNYMAVLTLTAEDAPNLSNIANSSEDSLLNNIILLINTEDa---DAISLDNISVS 584  Bacillus cellulosilyticus DSM 2522
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap