2O1G


Conserved Protein Domain Family
Glyco_transf_6

?
pfam03414: Glyco_transf_6 
Click on image for an interactive view with Cn3D
Glycosyltransferase family 6
Statistics
?
PSSM-Id: 397469
Aligned: 8 rows
Threshold Bit Score: 502.73
Threshold Setting Gi: 1022971466
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2O1G_A         7 V----------SLPRMVYPQpkvltpCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRlqNTTIGLTVFAIKKYV-AFLKL 75  human
XP_027821956 105 P----------EVPRLLYPKaqllkpSRVDVLVMTPWFAPIIWDGTFDSAILDAQFR--DTTIGLTVFAIKKYV-VFLRL 171 sheep
Q8VI38        49 KlpfrkekplqPVTQLQYPQpkllehGPTELLTLTPWLAPIVSEGTFDPELLKSMYQplNLTIGVTVFAVGKYT-CFIQR 127 house mouse
XP_008273648  62 V----------TLSRMLYPQpmvltpSRSDALTVTPWLAPIIWEGTFNIDLLNEQFWlqNLTVGLTVFAVKKYM-VFLKA 130 rabbit
P23336       109 P----------QLWDWFNPK------NRPDVLTVTPWKAPIVWEGTYDTALLEKYYAtqKLTVGLTVFAVGKYIeHYLED 172 house mouse
XP_013972332  27 KlqykgekpfqPVTRSPHPQpklleqRPTELLTLTPWLAPIVSEGTFNPELLQHIYQplNLTIGLTVFAVGKYT-RFVQH 105 dog
XP_016283253 110 P----------QLSDWFNPK------KRPDVLTVTDWLAPVVWEGTYHRKILEDYYTkqKITVGLTVFAVGRYLdRYLEE 173 gray short-tail...
XP_023485302  36 I----------PAP-CSHPLcfl-ssRRVDVLLMTPWFAPIIWDGTYDSAILDAQFR--NTTIGLTVFAIKKYV-VFLKL 100 horse
2O1G_A        76 FLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVGAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDV 155 human
XP_027821956 172 FLETAEKYFMVGHKVTYYVFTDRPADVPQIALRAGRQVVVLHVGSYRRWQDISMHRMEMISNFSRQRFLHEVDYLVCLDV 251 sheep
Q8VI38       128 FLESAEEFFMRGYQVHYYLFTHDPTAVPRVPLGPGRLLSIIPIQGYSRWEEISMRRMETINKHIAKRAHKEVDYLFCVDV 207 house mouse
XP_008273648 131 FLETAEQHFMVGHHVTYYVFTDRPADVPHVLLKEGRQLVVLSVRSYARWQDVSMHRMEMISNFSEQRFRHEVDYLVCSDV 210 rabbit
P23336       173 FLESADMYFMVGHRVIFYVMIDDTSRMPVVHLNPLHSLQVFEIRSEKRWQDISMMRMKTIGEHILAHIQHEVDFLFCMDV 252 house mouse
XP_013972332 106 FLESAEQFFMQGYQVYYYIFTNDPAAIPRVPLGPGRLLSIIPIQRHSRWEEISTRRMETISRHIAQRAHREVDYLFCVDV 185 dog
XP_016283253 174 FMTSAEKYFMVGQRVIFYIMVDDSSKIPWIQLGSLRTLKVFEINREKRWQDISMMRMKIIGEHIIHHIQYEVDFLFCMDV 253 gray short-tail...
XP_023485302 101 FLETAEKYFMVGHRVIYYILTDRPADVPQIPLQEGRRVVILKVRNYTRWQDVVLHRMEMISNFSQQRFLHEVDYLVSADV 180 horse
2O1G_A       156 DTEFRDHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQ 235 human
XP_027821956 252 DMKFSDHVGVEILAPLFGTLHPVFYAADRQSFTYERRPLSRAYIPRDEGDFYYAGGFFGGSVPEVYRLTTACHQAMAADQ 331 sheep
Q8VI38       208 DMVFRNPWGPETLGDLVAAIHPGYFAVPRRKFPYERRQVSSAFVADNEGDFYYGGALFGGRVARVYEFTRACHMAILADK 287 house mouse
XP_008273648 211 DMKFWDHVGVEILSPLFGTLHPAFYTANRKAFTYERRRRSQAYIPWDEGDFYYIGAFFGGSVAEVQQLTSACHQAMMVDK 290 rabbit
P23336       253 DQVFQDNFGVETLGQLVAQLQAWWYKASPEKFTYERRELSAAYIPFGEGDFYYHAAIFGGTPTHILNLTRECFKGILQDK 332 house mouse
XP_013972332 186 DMVFRNPWGPETLGDLVAAIHPGYYAVPRQQFPYERRHISTAFVAENEGDFYYGGAVFGGRVAKVYEFTTGCHMAILADK 265 dog
XP_016283253 254 DQIFKDDFGVETLGESVAQLQAWWYKADPTEFTYERRPESAAYIPFGQGDFYYHAAIFGGTPLRVLNLTQECFKGILQDK 333 gray short-tail...
XP_023485302 181 DMKFSDHVGVEILSSLFGTLHPGFYASDRQRFTYERRPLSQAYIPEDEGDFYYAAALYGGSVAEVYRLATACHQATLIDK 260 horse
2O1G_A       236 ANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLlGWPAVLRKLRFTAVPKNHQAVRN 296 human
XP_027821956 332 AQGIEAIWHDESHLNRYLLSHKPSKVLSPEYLWDEQMlQRPPLLRKLRYVAVPKNHGEIRN 392 sheep
Q8VI38       288 ANSIMAAWQEESHLNRHFIWHKPSKVLSPEYLWDERK-PRPRSLKMIRFSSVKKNANWLRt 347 house mouse
XP_008273648 291 AKGIEAVWHDESHLNKYLLHHKPTKVLSPEYLWGDWLlDWHPVLKKLRFVTVPKNRQKIRN 351 rabbit
P23336       333 KHDIEAQWHDESHLNKYFLFNKPTKILSPEYCWDYQI-GLPSDIKSVKVAWQTKEYNLVRN 392 house mouse
XP_013972332 266 ANGIMAAWQEESHLNRRFISHKPSKVLSPEYLWDDRK-PQPPSLKLIRFSTLDKATSWLRS 325 dog
XP_016283253 334 ENDIEAEWHDESHLNKYFLLNKPTKILSPEYCWDYHI-GSSSDIRLVKIAWQSKEYNVVRS 393 gray short-tailed opossum
XP_023485302 261 ANGIEAVWHEESHLNKYLLYHKPTKVLSPEYVWDERMlRKPPYLRRLRYVAVPKNHAQIRS 321 horse
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap