1U10


Conserved Protein Domain Family
Peptidase_M74

?
pfam03411: Peptidase_M74 
Click on image for an interactive view with Cn3D
Penicillin-insensitive murein endopeptidase
Statistics
?
PSSM-Id: 397467
Aligned: 75 rows
Threshold Bit Score: 318.371
Threshold Setting Gi: 262082626
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1U10_F                    17 SIGSFSNGCIVGADTLPIQSEHYQVXRTDQRRYFGHPDLVXFIQRLSSQVSNLGXGTVLIGDXGXPAGGRFNGGHASHQT 96  Esc...
Q0BS55                    32 IIGPAGNGCIAGAQRLPDEGPGWQTIRRDRSSFWSAPVTINGVKTLATRLHAQGLPDLYVGDMSAPHGGRLPGGHGSHQN 111 Gra...
CBS87602                  79 SIGGYAAGCVAGARALPPEGVGYQVIRLSRKRNYGHPVLVDMLRDFGQRVALAGLGTALIGDMGQARGGPMPSGHASHQI 158 Azo...
PRJNA391730:Sp245p_11440  59 SIGGYAAGCITGAQALPGEGTGYQVIRMSRQRYYGHPELIDYLKGFGRKVAAAGLGTALIGDMGQARGGPMSFGHASHQI 138 Azo...
Q7MNJ8                    38 SIGSYANGCLDGGVALPLEGAGYQVVRTERNRYFAHPETVNFIQELGYYADTHLASTLMIADVSLPRGGRFSFGHASHQT 117 Vib...
CAV17568                  34 SIGSYANGCLDGAQALPINGQGYQVIRPQRERYYGHTESIQFIERLGLTTSKQLNTNLLVGDISLPRGGRFSSGHSSHQT 113 Vib...
Q87S60                    36 SIGSYANGCLDGASPLPLEGTGYQVLRSRTNRYYGHPNTIDFVESLALKANQKLKTTLLIGDLSLPRGGRFSSGHSSHQT 115 Vib...
jgi:Tola_1281             27 AIGGYAAGCLQGAVALPEHGTGYQILRPRQKRIYGHPIMQQYVLDLARQSKKAGLPDILVGDMAMAKGGPFSSGHRSHQS 106 Tol...
IBRC:GU3_09710            23 AIGGYAAGCQTGAQALPQAGPGFYVVRAERQRYYGQPELIDYLHTLAQRAQQAGLPPLLVADMAKEHGGPFAYGHRSHQT 102 Oce...
jgi:Hoch_6120             58 AIGGYGAGCVQGAEELPVSGPGFHVVRPRRHRHFGHPVLIAYLRDLASRVRAAGGRDLLLGDLGQPRGGPAPSGHSSHQT 137 Hal...
1U10_F                    97 GLDVDIFLQlpktR----WTSAQLLRPQALDLVSRDGKHVVSTlWKPEIFSLIKLAAQDKDVTRIFVNPAIKQQLCLDA- 171 Esc...
Q0BS55                   112 GLDVDLYLDltprPa---LTPDERNVLEPPSMVSADGNSLSPA-WTQDTVTLLHMAATLPNVDRVLVNPVIKRALCEQV- 186 Gra...
CBS87602                 159 GLDADVWLRldlpP----MGRAGRERLEEIKYVDYDRMRVTED-WSDRQAKMVQIAASDARVSRIFVSPAIKLAMCQRN- 232 Azo...
PRJNA391730:Sp245p_11440 139 GLDADVWLRldhpP----MGRNARESLTEIKYVDYGRVRVTED-WSERQAQLVRIAASDPRVTRIFVNPAIKLAMCRHS- 212 Azo...
Q7MNJ8                   118 GLDIDVWLKlntsP----LNKYELEQAKTESVVNFDTMTIRADeWRDEQFELIRAAAENGRVARIFVHAVIKQRLCQME- 192 Vib...
CAV17568                 114 GLDIDIWLRltdkK----LSENELAVPKPLSVVDLTNYKLRESnWTDDHFQVIRYAAKDEKVVRIFVHPVIKHTLCEQEn 189 Vib...
Q87S60                   116 GLDIDIWLRladsP----LSYNELQLPKPMSVVDLQDYSILNHrWDKRHFELIRYAAKSDEVARIFVHPVIKEQLCAQE- 190 Vib...
jgi:Tola_1281            107 GLDTDFWFRfaakP----LSARTRNTIKPLDMVDFRRNKVNKN-FGQQQVTLLKLAAQDPRVERIFVNPPIKQAMCDQF- 180 Tol...
IBRC:GU3_09710           103 GLDADIWLRpgdtGlp----------aeEQDMVD-HRLYILNRhFGDDQRQLIALAAQDPRVSRIFVHPLIKQAMCRAY- 170 Oce...
jgi:Hoch_6120            138 GLDVDVWYRdpghDeqrpLRRRERRALRDRSVVV---DGALSAeMAPRVMRVLSLAADDERVARIFVNPVIKRDLCAQA- 213 Hal...
1U10_F                   172 --G-TDRDWLRKVRPWFQHRAHXHVRLRCPADSLECEDQPLPPSGDGCGAELQSWFEPpkpGTTKPEK-KTPP------- 240 Esc...
Q0BS55                   187 --S-GDRSWLHLIRPWWGHKAHMHVRFRCPAGQTLCVQAPPPPTGDGCDTTLAWWFQPhpaPPAAPPR-PPE-------- 254 Gra...
CBS87602                 233 --W-SDRAFLNKLRPWHGHDGHMHIRLNCPAGSPLCEQQTAPPDGDGCDDELMSWLSSaspAIERPLGyKPEPrv---vr 306 Azo...
PRJNA391730:Sp245p_11440 213 --W-PDRAFLRKLRPWHGHDGHMHIRLGCPAGSPQCEDQRDIPDGDGCGDEVASWLGSvypVVERHNG-KPQPry----v 284 Azo...
Q7MNJ8                   193 --TsTHRSWLRKVRPWWGHSSHMHVRLSCPQGSDDCIEQALPPEGDGCGEEVLSWIERptpTAKKAQEpE---------- 260 Vib...
CAV17568                 190 sdA-NGRAWLGKIRPWWGHHSHFHVRLKCPKGSSNCIAQASPPKGDGCGDELASWAPKtipVPPPKKVaKSKKkkr--vn 266 Vib...
Q87S60                   191 --GgKDRSWLRKVRPWWGHHYHFHVRLSCPDSSSNCVDQAPPPSGDGCGSELASWKPKtvvPAKPQPA-KVAAkpk-kkk 266 Vib...
jgi:Tola_1281            181 --GaTDPTWLGKLRPWFGHSAHFHVRLHCPVGSKDCEPQKPYPEGSGCGAELQSWLTKpamVSSKPLP-NRMP------- 250 Tol...
IBRC:GU3_09710           171 ----GDAPWLNRLRPWFGHSGHFHVRLHCPAASQHCEPQQAVPPGTGCGRELASWIDDrsgELAAGPR-QPWRp------ 239 Oce...
jgi:Hoch_6120            214 --G-EERDWLRKLRPWWGHDAHFHVRLECPDDSPECKAQAALPAGDGCD-EVSWWLDEerqAERKEER-GRYRknvrglp 288 Hal...
1U10_F                   241 PLPPSCQALLD 251 Escherichia coli
Q0BS55                   255 APPAACRPILA 265 Granulibacter bethesdensis CGDNIH1
CBS87602                 307 KMPAACAPVLN 317 Azospirillum lipoferum 4B
PRJNA391730:Sp245p_11440 285 SMPPACTPVLR 295 Azospirillum brasilense Sp245
Q7MNJ8                   261 PISEACVTVLN 271 Vibrio vulnificus YJ016
CAV17568                 267 VMPSQCLALIS 277 Vibrio tasmaniensis LGP32
Q87S60                   267 AIPPQCQPLIv 277 Vibrio parahaemolyticus
jgi:Tola_1281            251 DLPDRCEILLS 261 Tolumonas auensis DSM 9187
IBRC:GU3_09710           240 VLPAACRVLLA 250 Oceanimonas sp. GK1
jgi:Hoch_6120            289 ELPAACAPLLD 299 Haliangium ochraceum DSM 14365
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap