Conserved Protein Domain Family
FA_desaturase_2

?
pfam03405: FA_desaturase_2 
Fatty acid desaturase
Statistics
?
PSSM-Id: 397464
Aligned: 47 rows
Threshold Bit Score: 355.776
Threshold Setting Gi: 122955864
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KQJ90512         65 NLGGWVEQHLLPLLTPVDESWQPSDLL---PCLS--LSPrsaeqqqqATTTTEELQARAASVPDDVLVCLVGNMVTEEAL 139 stiff brome
CCH00156         10 FIGTKMDAFMNEFLKPIETNWQPADFL---PDST--QPS--------FFDKLRDLREQVAALSYDYLAVLVGDTVTEEAL 76  Fibrella aes...
jgi:Emtol_1909   13 FVGQKIDTFVDEFLKPIDTNWQPSDFL---PESS--NEN--------FLLDVRDLQETAKDLPYDYIAVLIGDTITEEAL 79  Emticicia ol...
Q0SEH1           13 ELEDVAEDNVNRHLV-MAKDWHPHDYV---PWDD--GRNf-------AALGGDDWNPEQSQLSDTARAAMITNLLTEDNL 79  Rhodococcus ...
WP_011741383     13 ELQPVVENLLNRHIS-MFKEWNPHDYV---PWSD--GKNy-------YALDGQDWEPGQSQLTDVAQVAMVQNLLTEDNL 79  Mycobacterium
UCNUF:IALB_0537  24 YLESKVKQWMEQHIA-KRKLWFSSDFL---PVDEknSDD--------QNKIVDGLRERAKGIKDSARVAVALNLLTEEGL 91  Ignavibacter...
BAH40788         17 DLEKDVEQLMEAHEA-KRILWFPSEILapePDTD-------------PDLHVKGLRERARGISMPSRVAICLNTLTEEGL 82  Gemmatimonas...
jgi:Sinac_3608   16 SLQGFVGENL-SLLAPVDQAWQPTDFL---PDLR--SKD--------WVEQLAAFRQSAERLSDELLVVLVGNMVTEEAL 81  Singulisphae...
jgi:Sinac_1176    6 SVQGFVGENL-SLLLPVDQIWQPTDYL---PDLE--SDN--------WSEQLAQFRETALRLPDELLVVLVGNMVTEEAL 71  Singulisphae...
WP_010908751     13 ELEPVVEKYMNRHER-LHKNWNPHDYI---PWSD--GKNf-------YALGGQDWDPEQSQLSDVAQVAMVQNLVTEDNL 79  Mycobacteriu...
KQJ90512        140 PTYMCMGNRAEAAHDATGCSPDPWARWLRGWTAEENRHGDLLNRYLYLCGRVDMRQVERTVHHLLRNGMRMPVp------ 213 stiff brome
CCH00156         77 PTYESWLMGMQGVNQE---DGQGWTRWVRGWTAEENRHGDLLNKFLYLSGRVDMRAMEVSTQYLIADGFDIGT------- 146 Fibrella aes...
jgi:Emtol_1909   80 PTYESWLIDVVGVDQVN--DPNGWAKWVRAWTAEENRHGDLLNKYLYLSGRVNMRAMETSTQYLIADGFDIGT------- 150 Emticicia ol...
Q0SEH1           80 PSYHREIAQHFS-------LDGAWGTWVGRWTAEENKHSIVMRDYLVVTRGVDPVALEQARMDHMTQGFDPG-------- 144 Rhodococcus ...
WP_011741383     80 PSYHREIAMNFS-------MDGPWGQWVNRWTAEENRHSTALRDYLVVTRAVDPVELEKLRLEQMTRGFSPGQnqqgdlf 152 Mycobacterium
UCNUF:IALB_0537  92 PHFHRLIAHHLG-------PDSFWSKWNNMWTAEEDRHGNILRDYARDSRLFRFKEVEMMQFYYQEAGFNPDW------- 157 Ignavibacter...
BAH40788         83 PHFHRLLATYLG-------GDTFWAKWNNLWTAEEDRHGAILHDYTRDSQLLDNPTFERMQFEYLKAGFEPSW------- 148 Gemmatimonas...
jgi:Sinac_3608   82 PNYTLPLSRI--ARDDTGTADEPWAKWLRGWTAEENRHGDLLNAYLRLTGRVNMRAVERTIHHLLKNGFNPRS------- 152 Singulisphae...
jgi:Sinac_1176   72 PNYTISLEHI--AKDPTGITDTPWAHWLRGWTAEENRHGDLLNTYLRLTGRVNMRSVETTVHHLIKNGFSPGS------- 142 Singulisphae...
WP_010908751     80 PSYHREIAMTMG-------MDGAWGQWVNRWTAEENRHGIALRDYLVVTRAVDPVELEKLRIEVVNRGFSPGQnhqgglf 152 Mycobacteriu...
KQJ90512        214 PSSPYHNVVYGAFQERATFVSHSRVARHAARHGDRCLARICGAVAADERRHETAYARAVGKLFEVDPDGMARALADVLRA 293 stiff brome
CCH00156        147 GSDPYRNFVYTSFQELATNLSHRRTATLAKQAGSPILSQMCGVIAADEMRHAKAYKAFVSEIFALDPSNMMLAFDDMMRK 226 Fibrella aes...
jgi:Emtol_1909  151 GRDPYRNFVYTSFQELATNLSHRNTAKLAKEYGNVPLAKICGVIAADEMRHAKAYKTFISHIFEVDPSEMMLAFEDMMKK 230 Emticicia ol...
Q0SEH1          145 GGSMLDSVSYVTFQELATRVSHRNTGKA---CGDPIADRMLARVAADENLHMMFYRNIVGAALDVAPDQAIAAIHKVVTN 221 Rhodococcus ...
WP_011741383    153 AESVFDSVMYVSFQELATRVSHRNTGKA---SNDPIAEQLMARVSHDENLHMIFYRDVSAAGLDIAPNQAMKSVHRILRN 229 Mycobacterium
UCNUF:IALB_0537 158 DKDPYKVFVYTTLQERATQFSHKNTGKLVGE-DEPLLNGILSNIAADEAKHFTFYRNVFKEVLNLDPNRAMVSASEIMPA 236 Ignavibacter...
BAH40788        149 DKDPYRVFVYTSLQERATQVSHANTGKLAGE-YEPLIGTVLSNVAKEEARHYVFYREIFKRVLDRDPNRALESAALIMPS 227 Gemmatimonas...
jgi:Sinac_3608  153 KDDGYSGLIYAAFQERATRITHMNVGKLAAAQGDEKLSKICRRIAGDEARHETFYTRVVGEIMERDPEGGTLAYRAVLKG 232 Singulisphae...
jgi:Sinac_1176  143 EGNNQAGLVYAAFQERATRMSHGNLARLADEQGEVNLALICRKIASDETRHEVFYTKVVAQLMDRDPEGTILAYRSMLKR 222 Singulisphae...
WP_010908751    153 ADTLFDSILYVTFQELATRVSHRNTGKA---CNETIADQLLAKISSDENLHMIFYRDVSEAGIELAPNLAIKALHKILHN 229 Mycobacteriu...
KQJ90512        294 KVTMPGQFMTDG--RDADLFARFSAVAQRAGVYTARDYGD-MVEHFVRRWKVPELggagGQMSGEGRRAQEYVCGLPRKI 370 stiff brome
CCH00156        227 KIVMPAHFLRETgvKIGETFAHFSDAAQRLGVYTVHDYIR-ILESLLIDWKIDVI----ADLSDEAQRARDYLMALPARL 301 Fibrella aes...
jgi:Emtol_1909  231 KIVMPAHFLRETgvKIGDTFAHFSDAAQRLGVYTTYDYID-IMESLLKDWKIDSI----RNLNDAGEKARDYVMALPTRL 305 Emticicia ol...
Q0SEH1          222 -FQMPGAGM--------HRFRRNAVLIAKGGIYDLRQHLDdVVLPVLRKWNMFER----NDFGPDGERCRDELAAFLQNL 288 Rhodococcus ...
WP_011741383    230 -FKMPGFTV--------PEFRRKAVIIAVGGIYDPRIHLNeVVMPVLKKWRIFER----EDFTGEAAWMRDDLGVLIKEL 296 Mycobacterium
UCNUF:IALB_0537 237 -IDMPGLSM--------PNFREMADVVRRVGIYGPRDYKN-IVEEAIKFWEIELI----TGLNEAAKKAQEKILAIPKRL 302 Ignavibacter...
BAH40788        228 -IDMPGINM--------PHFRDMADVIRRAGIYGPREYIK-IVEDLIKFWTIDKI----DGLNEAGRKAQEKIMSINARL 293 Gemmatimonas...
jgi:Sinac_3608  233 LIAMPGRLMGDG--KDPDLYDHFATVTQRVGAYTVRDYAQ-IIEHLNQSWGVTHR-----SLTGQAARAQDYLCRQPERY 304 Singulisphae...
jgi:Sinac_1176  223 MIAMPGARMNDG--RTPDLFDHYAAVTQRTGVYTSRDYGD-IIRHLNNAWNVGRR-----SVSGKAARAQDYICQQPERF 294 Singulisphae...
WP_010908751    230 -FKMPGFLV--------PEFRRKAVIIAVGGVYDIRIHLDeVVMPVLKKWRILER----EDFSGEGTRLRDEIGEHLTEL 296 Mycobacteriu...
KQJ90512        371 RRMEELAHDRVTkaAKEPe-FARFSWIF 397 stiff brome
CCH00156        302 TRVAERT-------KT-PslSYEFSWIg 321 Fibrella aestuarina BUZ 2
jgi:Emtol_1909  306 RRVAERT-------KV-PnlEYKFSWIa 325 Emticicia oligotrophica DSM 17448
Q0SEH1          289 EGKAARFEESRD--RALAreARRgerva 314 Rhodococcus jostii RHA1
WP_011741383    297 EQAGDKFDESKQ--RYLEreERRAEKIT 322 Mycobacterium
UCNUF:IALB_0537 303 EKVAEYVE------KRTEskTFSFDFIY 324 Ignavibacterium album JCM 16511
BAH40788        294 ERVADMME------TRSRakTFQFQVAF 315 Gemmatimonas aurantiaca T-27
jgi:Sinac_3608  305 EHAADGIAE-----RINQapPTPYTWID 327 Singulisphaera acidiphila DSM 18658
jgi:Sinac_1176  295 ERFADEIGE-----QVASqaPFSFSWIR 317 Singulisphaera acidiphila DSM 18658
WP_010908751    297 EAACDKFEVSKQ--RYIEreARRTEKIT 322 Mycobacterium leprae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap