Conserved Protein Domain Family
V1R

?
pfam03402: V1R 
Vomeronasal organ pheromone receptor family, V1R
This family represents one of two known vomeronasal organ receptor families, the V1R family.
Statistics
?
PSSM-Id: 112227
View PSSM: pfam03402
Aligned: 2 rows
Threshold Bit Score: 427.464
Threshold Setting Gi: 108861969
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9WUF1  38 KLLGENKPKPIDLYIAFLSLTQLMLLITMGLIAVDMFMPWGRWNSTTCQSLIYLHRLLRGLALSATCLLNVLWTITLSSR 117 house mouse
Q62850  39 KLICGQRSRLTDLPIGLLSLINLLMLLMTAFIATDTFISWRGWDDIICKSLLYLYRTFRGLSLCTSCLLSVLQAIILSPR 118 Norway rat
Q9WUF1 118 SSCLTKFKHKSPHHISGAFLFFYVLYMSFSSHVLVSIIVTPNLTSEDFMYVTQSCSLLPMSYSRESRFSTLMAIRETFLI 197 house mouse
Q62850 119 SSCLAKFKHKPSHHISCAILSLSVLYMFISSHLLVSIIATPNLTTNDFIHVTQWCSILPMSYLMQSMFSTLLAIRDVFLI 198 Norway rat
Q9WUF1 198 SLMALSSGYMVALLWRHKKQAQHLRSTSLSSKASPEQRATRTIMLLTSLFVVLYILERVVFQSRLKFKDCSVFYFVHIIM 277 house mouse
Q62850 199 SLMVLSTWYMVALLCRHRKQTRHLQGTSLSPKASPEQRATRSILMLMSLFVLMSVFDSIVCSSRTMYLNDPISYSYQLFM 278 Norway rat
Q9WUF1 278 SHSYATVSPFVFICTEKHIIKFWES 302 house mouse
Q62850 279 VHIYATVSPFVFIVTEKHIVNSLRS 303 Norway rat
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap