Conserved Protein Domain Family
TctC

?
pfam03401: TctC 
Tripartite tricarboxylate transporter family receptor
These probable extra-cytoplasmic solute receptors are strongly overrepresented in several beta-proteobacteria. This family, formerly known as Bug - Bordetella uptake gene (bug) product - is a family of bacterial tripartite tricarboxylate receptors of the extracytoplasmic solute binding receptor-dependent transporter group of families, distinct from the ABC and TRAP-T families. The TctABC system has been characterized in S. typhimurium, and TctC is the extracytoplasmic tricarboxylate-binding receptor which binds the transporters TctA and TctB, two integral membrane proteins. Complete three-component systems are found only in bacteria.
Statistics
?
PSSM-Id: 397461
Aligned: 5 rows
Threshold Bit Score: 387.988
Threshold Setting Gi: 122946869
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CAS:CtCNB1_3145  49 MGRAAAKAMSDKLGQPFVVENKAGAGGNIGTDAVAKAATDGYTIGLTAISSlAIAPHLYNSVPFDVEKDLRPISLVGTTP 128 Comamonas th...
CAP44093         34 IARIISRKMSESIGQQVVVDNRAGSGGIIGSDLVAKAPSDGHTILINSTGL-VVDRFFYPRVPYQSDRDFVPVVLAATLP 112 Bordetella p...
Q0KAS4           66 VARQVQEGLRKQLAQTVVIDNRAGAGGTIGTGQIARSAPDGYTVGMVFDSF-ATEPHFYPKLPYASHRDLTGVSYMVRSP 144 Cupriavidus ...
O30446           47 IARQAALGMAEKLGQPVIIENKPSAGHIVAMQTVAQATPDGYTILLGSNTGfTVAPHMYKNLPFR-IDTLQPIAPINTAP 125 Bordetella p...
Q0KBD4           53 pFRVLADNASKILGQPVIVENKPGAGGVLPAQMMQSTAPDGYTLAQVAMPV-YRLPYT-TKINWDPVKDLNYIINLAGYS 130 Cupriavidus ...
CAS:CtCNB1_3145 129 CALVINPGAPFSDLKGMVAYAKANPGKVNYATSGIGTSNHLAAELLQSVAGIQLTNVPYKGSSQIVPDLLSGTVMMsMES 208 Comamonas th...
CAP44093        113 SVLVVPADSRFRDITQLLKAARENPGKLSFASAGLGTSIHLASALLAARANVELLHVPYRGSSPAVSDLVAGRVDM-MID 191 Bordetella p...
Q0KAS4          145 MVLVVPAASPYKTVQDYVTAARV-PNKVSYASVGNGSSNQLVAEAFHEAAGTSGIHTPYKGGGPAINDLLGGHVDS-MIA 222 Cupriavidus ...
O30446          126 TVLLARPDFPANNLTELIQYIKDNPGKLNYGSFGIGTSAHLGMEIMKSDLGLNIMHIPYRGDAQGLLALKAKEVDI-AYI 204 Bordetella p...
Q0KBD4          131 FGLVVPADSPIKTMQEYIAYAKANPGKLTYGSPGSMTTLHLTMEELAMKQGVQFSHIPYKGNSESMQALLGGHVMS--VA 208 Cupriavidus ...
CAS:CtCNB1_3145 209 SLATTLQHIKAGKLRAMAVTSPQRSKALPDVPTVAESG-YPGFEVETWFGLVAPAATPQAVITKLHQAWEVGAKTGEVQQ 287 Comamonas th...
CAP44093        192 SVTSQRQNILAKRVRALGVTSLDRHPQLPEVPTIAEAAgLPGFEVLTWCGVFAPKGTPRSVVERLNAEINKAIAAPDVVE 271 Bordetella p...
Q0KAS4          223 SLPLVLPYVQSGKLRALAVTSRQRDARLPAVPAVAES--YKGFEAYSWVGMIAPAKTPPEVLGKLTTAMTSTLRNPAIAK 300 Cupriavidus ...
O30446          205 TLFSAQARIRAGEFKALGVLQNDRLTAFPDIQTTVEVG-SKNSGMPVWIAFFAPPGTPDAVMRKLESATRSASTAPAFVE 283 Bordetella p...
Q0KBD4          209 DTPAWAPYVEQGKLRLLSTWGEKRSARFPSVPTLKELG-I-GIVQTSPFGLVAPKGTDPKIVQKLHDAFKKAMDMPNYRE 286 Cupriavidus ...
CAS:CtCNB1_3145 288 AFDNISGNLRVNTPQQFADFIRAENKRWGDLIRKLG 323 Comamonas thiooxydans
CAP44093        272 ALKQLGIKTAGGAPEVLADLFKSETERWQKLIVEHR 307 Bordetella petrii
Q0KAS4          301 LLTDGGFDVVAGDAQQTNKLIQDESARWGRLIKARN 336 Cupriavidus necator H16
O30446          284 FLHNNGVEPWNPSNQDLMRFIQDQLNRSGPIIQEIG 319 Bordetella pertussis Tohama I
Q0KBD4          287 SLAKFDMEPYYMNSQQYAQFAAETVKKEKAIIEKLG 322 Cupriavidus necator H16
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap